KEGG   Listeria monocytogenes L99: lmo4a_2573Help
Entry
lmo4a_2573        CDS       T01989                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lml  Listeria monocytogenes L99
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:lml00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2633675..2634307)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASIRIGSKDAHPQNAVWVVD
SKDEMLAKLEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEQLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKEQLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccgcttttgatattgatgcacaaaaaggctttacaccgctttgtcccgat
gaattaccggtttcgggcggagacaaaattgtgccagaacttaattttatggcaagcctt
gcttctattcgaattggtagtaaagatgcgcatccgcaaaatgctgtatgggtagttgat
tccaaagacgaaatgctggctaaactcgaatatccaaatgcagaccgtacttgggtaagg
cactgtgaaccaggtacaaaaggttttgaattattagatggtttaccagttgtgactgat
tatgattactttatttggaaaggtatggagccggacattcatccgtacggcgcttgttac
cacgatattgtcgaacagctttcaactggagtacttgagtatttacgcgaacaaaaagtt
gatttagttcttgttggaggtttagcttttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcattatctgaa
caaggttttgatgaaacaaaagagcaattagcaaataccgagaaagtgcaacttatcgaa
acaagggaggaacttgtcgcctattgccagtaa

DBGET integrated database retrieval system