KEGG   Listeria monocytogenes L99: lmo4a_2783Help
Entry
lmo4a_2783        CDS       T01989                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lml  Listeria monocytogenes L99
Pathway
lml00010  Glycolysis / Gluconeogenesis
lml00620  Pyruvate metabolism
lml00640  Propanoate metabolism
lml00680  Methane metabolism
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01120  Microbial metabolism in diverse environments
lml01130  Biosynthesis of antibiotics
lml01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo4a_2783 (acsA)
   00620 Pyruvate metabolism
    lmo4a_2783 (acsA)
   00640 Propanoate metabolism
    lmo4a_2783 (acsA)
  Energy metabolism
   00680 Methane metabolism
    lmo4a_2783 (acsA)
Enzymes [BR:lml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     lmo4a_2783 (acsA)
Lipid biosynthesis proteins [BR:lml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   lmo4a_2783 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAR85487
Position
2820943..2822520
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaacaaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacttacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgatcattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactgga
ttcatttacaacggtcgtttcattccagaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctctgctgtacgccgacagaatatcgcttaatggcaaaggttaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagttattcaagttttccaagataattttgatattaaagttcgcgacggctacggccaa
acggaaagcacgctgttgattggaacacttgttgatacgccgattcgccctggttcaatg
ggcaaaccaattatgcctgaatacatggcgattattgatgctgacggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaggagtac
tataaagaaccagaacgtttgcaaaaagcgattcgtggcgattactttgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
atcagctctggctacacgattggcccgttcgaagtcgaggacgcgctcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagtcctgatgaaatccgcggtacggtcgtaaaa
gcattcatcgtcttaaaagatggttacgagggcacggaagatcttgtgcacgaattacaa
acatttacgaaagaacaaactgctccgtataaatatccgcgccggattgagtttgttgag
gcgttaccgaaaactgattctggtaaaattcgccgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system