KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_00035Help
Entry
MI1_00035         CDS       T01768                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MI1_00035
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MI1_00035
Enzymes [BR:lmm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MI1_00035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9403..9876
Genome map
AA seq 157 aa AA seqDB search
MSIYDYFATLENGETYSLNKLANHPVVIVNTATKCGYAPQFGELEKLYKKYKDKGLVILG
FPSNQFKQELETASQAAQACQLTYGVTFPMHQLVAVNGKNTDPLFKYLKENSKGMLGSST
IKWNFTKFLVDKEGNVVKRYAPKTEPKDLEEDIEDVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatacgattattttgcaaccttagaaaacggagaaacttattcacttaataag
ctagccaatcatccagtagtgattgttaatactgctacgaagtgcggctatgcaccacaa
tttggtgagttagaaaaattatataagaagtataaagataagggactagtaattttaggc
tttccatctaatcaattcaaacaagagttagaaaccgcatcacaagcagcccaagcatgt
caacttacttatggtgtaacttttccaatgcatcaactagttgccgtgaatggtaaaaac
acagatcctttgtttaaatatttgaaagagaattcaaaaggaatgctgggtagtagcaca
atcaaatggaattttacaaagtttttagtggataaggagggaaacgtcgtaaaacgctat
gccccaaaaacagaacccaaggatcttgaagaagatattgaagatgttttatga

DBGET integrated database retrieval system