KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_00525Help
Entry
MI1_00525         CDS       T01768                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MI1_00525
   00051 Fructose and mannose metabolism
    MI1_00525
Enzymes [BR:lmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     MI1_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108894..110240
Genome map
AA seq 448 aa AA seqDB search
MAELFDFPQVTFVGTQSLQAGDGFHYYNPDEIVKGKKMSDWLKFSVTYWHTMDQRLVDPF
GEGTAVRPWDNQGKPDSMEQALAKVDYLFEFLEKTDVNYFAFHDRDLAPEGNTLAETNKN
LDQVIGKIEQKMHETGKKLLWNTSSLFTNKRFLAGGATTPFAEVFAYAAGQIKHSLDIAK
RLGSESYVFWGGREGYDFLLNTDTKRELDHIAAFFKLAKDYANEIGYQGQFLIEPKPKEP
TQHQYDFDVQTTIAFLKTYGLEDTFKLNLEGNHAYLAGHTYEHEVRFAREAGLLGSLDAN
MGDKLTGWDIDEFPNDVYEATLVMYEFLKNGGLPTGGLNFDSKARRQSFQADDLFYAHIA
GMDTYAAGLKVAAKLIDDQVIENVLKERYASFDSGIGADFEAGKVTLKELATYIENKTDE
EINATLKSGRQERIKQTLNNYIFSVLGS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactttttgattttccccaagtaacatttgtaggaacacaatcattacaagcg
ggtgatggatttcattattataatccagatgaaatagttaaaggtaagaaaatgagtgac
tggctaaagttttcagtgacttattggcatacaatggaccaacgcttagtagacccattt
ggtgaaggaacagcagtccggccgtgggacaatcaaggtaaaccagattcaatggagcaa
gcattagcgaaggttgattatttgtttgagtttttggaaaaaactgacgtgaactacttt
gccttccatgatcgtgatcttgcacctgaagggaatacacttgccgaaacaaataaaaat
ttagatcaagttattggcaaaattgaacaaaaaatgcatgaaacaggtaaaaaactttta
tggaatacttcatcactatttacgaataaacgttttttggctggtggcgcaactacacca
tttgctgaggtatttgcttatgcagctggacaaattaagcattcattagatattgccaag
cgcttaggatcagaatcatatgttttctggggcggacgagaaggctacgactttctatta
aatactgacaccaaacgtgaattagaccatattgcagcattctttaagctagctaaggat
tatgcaaatgaaattggttatcagggacaattcttgattgaacccaagcccaaagaacca
acacagcatcaatatgattttgatgtgcaaacaacaattgctttcttgaaaacttatgga
ttagaggatacattcaagttgaacttggaaggcaatcacgcctacttagctggtcacacg
tatgagcatgaagtgagatttgcgcgagaggctggtttgttagggtcattagatgctaac
atgggtgataagctcactggttgggacattgatgaatttccaaatgatgtttatgaggcg
accttagtaatgtatgaattcttgaaaaacgggggtctaccaactggtggtttgaatttt
gattcgaaagcacgccgtcaaagtttccaagctgacgatttgttctacgcgcatattgct
ggtatggatacttatgctgctggcttgaaagttgctgctaagctaattgatgaccaagtg
attgaaaatgttctgaaagagcggtatgcttcatttgattcgggtattggcgctgatttt
gaagctgggaaagttaccttaaaagaattggccacctatattgaaaataaaacagatgaa
gaaatcaacgcaaccctcaagtcaggtcgccaagaacgaatcaaacaaacattgaataat
tacattttttctgtacttggatcttaa

DBGET integrated database retrieval system