KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_00600Help
Entry
MI1_00600         CDS       T01768                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MI1_00600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_00600
   00620 Pyruvate metabolism
    MI1_00600
   00650 Butanoate metabolism
    MI1_00600
  Lipid metabolism
   00071 Fatty acid degradation
    MI1_00600
  Amino acid metabolism
   00350 Tyrosine metabolism
    MI1_00600
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MI1_00600
   00626 Naphthalene degradation
    MI1_00600
Enzymes [BR:lmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MI1_00600
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MI1_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124605..127307
Genome map
AA seq 900 aa AA seqDB search
MAEAIAKKPAKKVLTPEEKAELQTQAEKMTEVLIEKSQKALSEFSTFSQEQVDKIVAAMA
LAGSENSLLLAHAAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGILAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKASVLAAKIVYDAAVK
AGAPENFIQWIEKPSLYATSALIQNPHIASILATGGPSMVNAALKSGNPSMGVGAGNGAV
YIDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEILTKLQEQGAYLVPKKDY
KKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPDGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIETVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYEANAITYLQDLPTINRAFIVADPGMVQFGFVGRVLGQLELRQEQVETNIYGSVK
PDPTLSQAVEIARQMADFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILEDDEAIKD
LFLELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLADY
ELTPEVAIVDPEFVMTVPQHTVSWSGLDALSHALESYVSVMASEFTRPWALQAIKLIFDN
LTNSYNYDPKHPTKEGQNARTKMHYASTLAGMSFANAFLGLNHSLAHKTGGEFGLPHGMA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGETDAELVDVLIAEI
KKLAASVGVNQTLSGNGVSKHDFDTKLEKMIDLVYNDQCTPGNPRQPSLAEIRQLLKDQF
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcaattgcaaagaaacccgcaaaaaaggttttgacccctgaagaaaaagcg
gaattacaaacacaagctgagaagatgactgaggtattgattgaaaaatcacaaaaggca
ttgtctgaattttcaacattttcgcaagaacaagttgataaaattgttgcagctatggcc
ttggcaggttctgagaattcacttctgttagcccatgctgctcacgacgagactggacgt
ggggttgtggaagataaggatacgaaaaatcgtttcgcctcagaatcagtttataacgct
attaagtttgataagactgtgggtgttattagtgaagacaagattcaaggtaaggtagaa
ttagcagccccacttggtattttggctggaatcgtcccaacgacaaatccaacgtcgaca
actattttcaaatcaatgttgacagcaaagacacgtaacacaattatctttgctttccat
ccccaggctcaaaaagcatcggttcttgctgcaaaaattgtttatgatgctgctgttaaa
gcaggcgcaccggaaaactttatccaatggattgaaaagccttcactttatgcaacaagt
gcgctgatacaaaatcctcacattgcttcaattctagctactggtgggccatcaatggtt
aatgcagctttgaagtcaggaaatccatccatgggtgtcggtgctggaaacggtgcagtt
tatattgatgcaactgttgacacagatcgtgccgtgtccgatttgttgttatcaaagcgt
ttcgataatggcatgatttgtgccacagaaaactcagccgttattcaagcaccaatctat
gacgaaattttaactaagttacaagaacaaggtgcataccttgttcctaagaaagactac
aagaaaattgctgattatgtctttaagcctaatgcagagggatttggtattgctggtcct
gttgctggtatgtcaggacgttggattgctgagcaagcaggcgtaaagattcctgatggt
aaagatgtacttttgttcgaattagatcagaagaacataggtgaagcgttatcttctgaa
aagttatcgccattactttcaatttataaagttgagaagcgtgaagaagctattgagact
gttcaatccttgttaaactatcaaggcgcagggcacaacgcagcaattcaaattggttca
caagatgatccattcattaaagagtatgctgacgctattggtgcatcacgtattttggtt
aaccaacctgactcaatcggtggcgttggggatatttatacagatgctatgcgtccatcg
ttgacacttggtaccggatcatgggggaagaattcattgtctcataacttatcaacatac
gacttacttaatattaagaccgtggctcgccgccgtaatcgtcctcaatgggttcgttta
cctaaggaagtttactacgaagccaatgccattacttacttacaagacttgcctactata
aaccgtgcatttattgtcgctgatcctggtatggttcagttcggatttgttggcagagta
ctaggtcaacttgagttacgtcaagaacaggttgaaacaaatatctatggttcagttaag
cctgacccaactttgtcacaagctgttgaaattgctcgccaaatggcagacttcaaacca
gatacagttattttacttggcggtggttcggcacttgacgctggtaaaattggtcggttc
ttgtacgaatactcgacacgccatgaaggaattttagaagatgacgaggcgattaaagat
ctattcttagaactacaacaaaagtttatggatattcgtaagcgaatcgttaagttttac
cacgcacgtttgacacaaatggttgcgattccaacaacttcaggtactggatcagaagtc
acaccatttgccgttattacagatgatgaaacacatgtaaagtatccactagccgattat
gaattgacaccggaagttgctattgttgatccagaatttgttatgaccgtaccacaacac
acggtatcttggtcaggattagatgctttgtcacatgctttggaatcgtatgtctcagtg
atggcttctgaattcacacgtccttgggcattacaagctattaagttgatttttgataac
ttaacaaattcatacaattatgatcctaaacacccaactaaggaaggtcagaatgcacgc
acaaagatgcactatgcgtcaacattggctggtatgtcatttgcgaatgccttcttggga
cttaaccactcactagcacacaaaactggtggagaattcggactacctcacggtatggca
atcgctattgcaatgccacatgtgattaagtttaatgcggtaacaggaaatgtaaagcgc
acaccatacccacgatacgaaacctatacagcacaaaaagattatgctgatattgcacgt
tacttaggtttgaaaggtgaaacagatgctgaattggtcgatgtattgattgcagaaatc
aagaagttggctgcatcagtgggtgtcaatcaaacactatctggcaacggtgtttcaaag
catgactttgatacaaagttagaaaagatgattgacttagtttacaatgaccaatgcacg
ccgggaaaccctcgccaaccaagcttggcagaaattcgtcaattgttgaaagatcagttt
taa

DBGET integrated database retrieval system