KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_00945Help
Entry
MI1_00945         CDS       T01768                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MI1_00945 (tpiA)
   01230 Biosynthesis of amino acids
    MI1_00945 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_00945 (tpiA)
   00051 Fructose and mannose metabolism
    MI1_00945 (tpiA)
   00562 Inositol phosphate metabolism
    MI1_00945 (tpiA)
Enzymes [BR:lmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MI1_00945 (tpiA)
Exosome [BR:lmm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MI1_00945 (tpiA)
  Exosomal proteins of bladder cancer cells
   MI1_00945 (tpiA)
  Exosomal proteins of melanoma cells
   MI1_00945 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192680..193489
Genome map
AA seq 269 aa AA seqDB search
MSQHNASRIPFVVANWKINKLHADVAEFLDKVNGKVPAENVVETGIAAQDLFLSDMVRAT
AQSPIHIVAENVHWEDSGAYTGETSPKALKDIGAKYVLIGHFERRKFFNETDSTVNLKVT
AALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVDQIRNVTLAYEPTWAIGS
GEAASAVQAQKAAHLIRQTLAKLYSPVIAEQVRVLYGGSVTPDNAREIMLQKDIDGVLVG
TSALDPEKFLQLVAIAQDPEVPEFNIENT
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacataatgcttcacgtataccttttgtagttgcaaattggaaaattaataag
ttgcacgctgatgttgcagaatttttggacaaggtgaacggtaaggtgcctgctgaaaat
gttgtggaaacaggtattgcggcacaagatttattcttgtcagacatggttcgagctaca
gcacagtcacccatacatattgtcgcagaaaatgttcattgggaagacagtggagcttac
acaggcgaaacatcaccaaaagcattgaaagatattggcgccaaatatgttttaattggg
cattttgaacgtcgaaagttttttaatgagactgattcaacagttaatttgaaagtcact
gctgcacttagaaatggcttacgcccaattatcgatgtcgatgaggatatgagtacctat
gcccagtttatggacgcggaaccctcagtggctcaagtggctgccgcgttggcaggcgtc
tctgttgaccaaatccgcaacgttacacttgcgtatgagcccacatgggcaattggatca
ggtgaggccgcaagtgcggtccaagcgcaaaaagcagctcatctgatacgtcagacgctg
gccaagttatattcacctgttattgctgaacaagttcgcgttttatatggcggatcggtg
acaccagacaacgctcgcgaaataatgttgcaaaaagatatagatggtgtgttggttggc
acatccgctcttgatccagaaaagtttctacaacttgttgccattgcgcaagatccagaa
gtcccagaatttaatattgagaatacttaa

DBGET integrated database retrieval system