KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_01135Help
Entry
MI1_01135         CDS       T01768                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MI1_01135 (recR)
DNA repair and recombination proteins [BR:lmm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MI1_01135 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
227747..228352
Genome map
AA seq 201 aa AA seqDB search
MQYPEPIAKLIDSYTKLPGIGPKTATRLAFYTLGMNEEDVQDFSKALISAKTDLTFCSIC
GNITATDTDPCVICRDQSRDQSTVFVVENSRDVMAMENTRDYHGLYHVLNGVISPSAGTG
PEDINLPSLIRRLSEHEEIKEVIVGTNANAEGEATAMYLARLLKPAGIAVTRLAHGLAVG
SDIDYADELTLIKAVQGRTKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccctgaacctatcgctaaattaatagatagttacacgaagttacctggcatt
ggtcccaaaacggccacaaggctagctttttatacattaggtatgaatgaagaagatgtg
caggatttttctaaggcattgatttccgcaaaaactgatttaactttctgctctatttgt
ggtaatattactgcaactgataccgatccatgcgttatttgtcgcgatcaatcacgtgat
cagtcaactgtttttgttgtcgaaaattcacgtgatgtaatggcgatggagaatacgcga
gattatcacggcctatatcatgttttaaatggtgttatttctcctagcgcaggaacagga
ccagaggatattaatttaccaagtttgattcgacgtttgtctgagcatgaagaaattaaa
gaagtaattgtcggcactaacgcgaatgctgaaggagaagctactgctatgtatttagca
cgtttactgaaaccggctggtatcgcagttacccgtttagcacatggtttagctgttgga
tctgatattgattatgctgatgaactaacactcattaaagcagtacaaggacggacaaaa
ttatga

DBGET integrated database retrieval system