KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_01655Help
Entry
MI1_01655         CDS       T01768                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MI1_01655
Enzymes [BR:lmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MI1_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330933..332411
Genome map
AA seq 492 aa AA seqDB search
MEIQNKAMLITYADSLGKNLKDVRKVLKEDIGDAIGGVHLLPFFPSTGDRGFAPSDYTRV
DSAFGDWSDVEALGEEYYLMFDFMINHISRESVMYQDFKKNHDESKYKDFFIRWEKFWAK
AGENRPTQADVDLIYKRKDKAPTQEITFDDGTTENLWNTFGDEQIDIDVNSAIAKEFIKT
TLEDMVKHGANLIRLDAFAYAVKKVDTNDFFVEPEIWDTLNEVREILTPLKAEILPEIHE
HYSIPKKINDHGYFTYDFALPMTTLYTLYSGKTNQLAKWLKMSPMKQFTTLDTHDGIGVV
DARDVLTDEEIDYASEELYKVGANVKKTYSSASYNNLDIYQINSTYYSALGNDDAAYLLS
RIFQVFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYSVDEVKEEVKRPVVAKLL
KLLSWRNNFAAFDLDGSIDVETPSDTTIKITRKDKSGENVAVLVANAADKTFTITANGEE
ILANAEADKQQL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcaaaataaagcaatgctcatcacatacgctgattcattgggtaaaaacttg
aaggatgttcgcaaagtcttgaaagaagatattggtgatgcaattggtggtgttcacttg
ttgccatttttcccatcaacgggagaccgcggttttgcaccttctgattacacacgtgtt
gattcagcatttggtgattggagtgatgtagaagcattaggtgaagaatattacttgatg
tttgatttcatgattaaccatatttcacgtgaatctgttatgtatcaagatttcaagaag
aatcatgatgaatcaaaatataaggatttcttcattcgctgggaaaagttctgggccaag
gctggtgaaaaccgtccaacacaagccgatgttgacttgatttacaagcgtaaggataag
gcaccaactcaagaaattacttttgatgatggtacaactgaaaacttgtggaacacattt
ggtgatgaacaaattgatatcgatgtaaactcagctatcgctaaagaatttatcaagaca
acgcttgaagacatggtgaagcatggagctaacttgattcgtttggatgcctttgcatac
gctgttaaaaaagttgatacaaatgacttcttcgttgaacctgaaatctgggacacattg
aacgaggttcgtgaaattttgacacctttgaaggccgaaattttgccagaaatccatgaa
cactattcaattcctaagaagatcaatgatcatggttacttcacatatgattttgctttg
ccaatgactacactttatacattgtattcaggtaaaacaaatcaattggctaaatggttg
aagatgtcaccaatgaagcaatttactactttggatacgcacgacggtataggtgttgtt
gatgcgcgtgacgtcttgactgatgaagaaattgattatgcatctgaagagttatacaaa
gttggtgctaacgtgaagaagacttactcttctgcttcatacaacaacttggatatctac
caaatcaactcaacatattactcagctttgggaaatgatgatgctgcatacttgctaagc
cgtatcttccaagtgttcgctcctggtattccacaaatctactatgttggtttgttggcc
ggtgaaaatgatattgaattacttgaatcttcaaaagaaggtcgtaacatcaaccgtcat
tactactcagttgatgaagttaaggaagaagttaagcgcccagttgttgctaagttgttg
aagcttttgtcatggcgtaacaactttgctgcatttgatttggacggatcaattgacgtt
gaaacaccatctgatacaactatcaagattactcgtaaggataagtctggtgaaaatgtt
gcagtcttggttgccaacgctgccgataagacattcacaatcactgcaaatggtgaagaa
atcttagccaacgcagaagctgataagcaacaattgtaa

DBGET integrated database retrieval system