KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_02700Help
Entry
MI1_02700         CDS       T01768                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00040  Pentose and glucuronate interconversions
lmm00052  Galactose metabolism
lmm00500  Starch and sucrose metabolism
lmm00520  Amino sugar and nucleotide sugar metabolism
lmm01100  Metabolic pathways
lmm01130  Biosynthesis of antibiotics
Module
lmm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MI1_02700
   00052 Galactose metabolism
    MI1_02700
   00500 Starch and sucrose metabolism
    MI1_02700
   00520 Amino sugar and nucleotide sugar metabolism
    MI1_02700
Enzymes [BR:lmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MI1_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AET30000
Position
563275..564150
Genome map
AA seq 291 aa AA seqDB search
MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIESGIEDIVIVDGKS
KRSIEDHFDSNPELENNLREKGKDELLKLVEETTDINMYFIRQSHPKGLGDAVLTAKAFI
GDEPFVVLLGDDLMQDEVPLTKQLIQRYEETGESTLAVMKVPHDQVSEYGVIDPAAQVDK
GGLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTKPGKGNEIQLTDAIDSLNN
RQHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTKDALRAYIKELASKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacgtaaagctattattccagcagcaggattgggcacacgttttttgcca
gcaactaaggcattagctaaagaaatgttgccaatcgttgacacaccaacgattgaatac
atcgtgcgtgaagcgattgaatctggcattgaagatatcgttattgttgatggtaaatca
aagcgttccatcgaggatcattttgattctaacccagaattagagaataatttacgtgaa
aaaggaaaggatgaattattaaagcttgtcgaggaaacaacagatattaatatgtatttc
atccgtcaatcacatcccaagggtctcggtgatgctgtactgactgctaaagcgtttatc
ggtgacgaaccgtttgttgttttgctgggtgatgacttgatgcaagatgaagtaccgttg
acaaaacaattgatccaacgttatgaggaaactggtgaatcaacgttagctgttatgaaa
gtacctcacgatcaagtatcagaatacggtgtaatagatccagccgcgcaagttgataaa
ggtggactatatcgtgtaaagagcttcgttgaaaagccaaagcctgaagatgcaccttca
gacctagcgattattggccggtaccttttgacacctgaaattttcgaggaactagaaaat
acaaaacctggtaaaggaaatgaaattcaattgactgatgctattgattcattgaacaac
cgtcaacacgtatatgctcatgaatttaagggtagccgttatgatattggttcaaaaatt
ggcttcttggaaacaaacattgaatttggtttaaagcatccgcaaacaaaagatgcatta
cgtgcttatattaaagaattggcatcaaagttgtaa

DBGET integrated database retrieval system