KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03170Help
Entry
MI1_03170         CDS       T01768                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662173..664560
Genome map
AA seq 795 aa AA seqDB search
MAYPEKQLDKMTGTLQNVIFSSTESYFKILSVHIEESTLEDWQEPEMIATGTFADVQEGS
VYGFYGQLVRHPKYGQQFKVDHYENELPPDENGLIKYFASGQFAGIGKKTAEKIVNHLGL
NAVNLILDDAKILDGIVKAETARKLARTLRLNLGLERLFQIGNQFGIGADIAGRLYDQYG
NEAQDILTQDPYRLVFEFDGISFKKADDIGHKVGVDKFDERRMQAAVYATIMNVTFQYGH
MFLSHDQLLLSVEQMLHQNNTEMSNQIQKAIQSLIESNILVNDDGRYYAKRLYIAEKETA
INLKRLLNTSSPLNITANDINESFVTPGQMTLDQTQVEAVKTGLKSQIFLLTGGPGTGKT
TIIRTMVATWKKMIQNRAKFADNTKDFLKNYQVRMASPTGRAAKRMTEVTGYDASTIHRL
LGIADLDEPEFNADNPIAGSLLIIDEASMLDIELTSKLLAAVPNGMKVIIVGDSDQLPSV
GPGNVLEDLVSSGDITHIELEVIYRQGRGSSITELATHIKNGELPTDFLENQPDRSSFMV
NSEQASQAIEQVVALAIKKGYTQDDLQILTPMYKTSAGVIALNQMAQKLFNPLKSNQKSL
QFGMTIFRKGDKVLQLENDSERDVYNGDMGKIIAVQYKSDIGNDDNEDRLIIDFDGKELA
YPKKNLNQLSLAYATTVHKAQGNEFQLVIMVLTNHFGLMLNRNLLYTGITRAKEALILVG
EYTAFERASRTLVPKRFTFLQQRLSHSKTEVNEHDSSDESETIPEKTPHLTTTMVISSAV
NPMIGMENITPYDFM
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcatacccggaaaaacaattagataaaatgactggcacgttacaaaacgttattttt
tcatcgacagaatcctattttaaaattttgtcggtacatattgaagaatcaactttagaa
gattggcaagagccagaaatgattgccactggaacatttgctgacgtccaagaaggaagt
gtatacggattttatggccaattggttcgacatccaaagtacggacagcaatttaaagtc
gatcattacgaaaatgaactgcctcccgatgaaaacgggttgattaagtattttgctagt
ggccaatttgctggaattggtaaaaaaacggctgaaaaaattgttaatcatttgggattg
aatgctgtcaatctaattctagatgacgcaaaaattcttgacggtattgtaaaagcagaa
acagctcgaaaactggcgcgtacgttgcgacttaacttaggtctagaacgcttgttccaa
attggcaatcaatttggtattggtgcggacattgccggacgtttatatgatcaatacggt
aatgaggcacaagacattttaacgcaagatccttaccgtttagtatttgaatttgatggc
attagttttaaaaaagccgatgatattggtcataaggttggtgtagataaattcgatgaa
cggcgtatgcaagccgctgtttacgcaacaattatgaatgtgacgtttcaatatggtcat
atgtttttatcacacgatcaactattattgtcagtcgagcaaatgttgcatcaaaacaat
accgaaatgtcgaatcaaattcaaaaggccatccagagcttaattgaaagcaatattttg
gttaacgatgatggccgttattatgcgaaaaggttgtacattgctgaaaaagaaacggct
attaacttaaaacgattattaaatacaagttctccattgaatataacagcaaatgatatt
aatgaatcatttgtgacgcctggacaaatgacgctcgatcagacacaagttgaggcggtt
aaaactgggttgaaatcacaaattttcttgttaacaggtggaccaggaactggaaaaacg
acaattatccgcacaatggtcgccacttggaagaaaatgattcaaaatcgtgcaaagttt
gcagacaatactaaagactttctcaaaaattatcaggtcagaatggcttcaccaacagga
cgtgcagcaaagcggatgactgaggtaacgggttatgatgcttcgacaatccatcggcta
ctgggtattgctgatttggatgagccagagtttaatgcggataatcctatcgcaggcagt
ctactaataatagatgaagcgtcgatgctagatattgaattaacttcaaaattgctagca
gcggttccaaatgggatgaaggtaattatcgtcggagatagcgatcaactaccgtcggtt
ggaccaggcaatgtattagaggatttagtgagtagcggagatatcactcatattgaatta
gaagttatctatcgacaaggccgtgggagcagtattactgaacttgcaacgcatattaaa
aacggtgagttaccaacagatttcttagagaatcaaccagatcgttcgagttttatggtg
aattcagagcaagcttcgcaagcaattgaacaagtggttgcattggcgattaaaaaaggt
tacacgcaagacgatttgcaaatattaaccccaatgtacaaaacatctgccggtgtaatt
gccttaaatcaaatggctcaaaaattgttcaatccgcttaaatcaaatcaaaaaagtttg
cagtttggaatgacaattttccgaaagggtgataaggtcttacagctagaaaatgacagc
gagcgagatgtttataacggagatatgggcaaaataattgctgtccagtacaagtctgac
attggcaatgatgataatgaagatcgcctcatcattgattttgatggtaaagaattggct
tatcccaaaaaaaatttgaatcaactgtcattagcgtacgctacgaccgtccataaagca
caaggtaacgagtttcaattggttatcatggttttgacaaatcattttggtttaatgctt
aatcgaaatttattgtatacaggaattaccagagccaaagaggctttgattcttgtggga
gaatacaccgcatttgaacgtgcttcacgcacactggtgccgaaaagattcacattcctg
caacaaaggttgagtcacagcaaaactgaagttaatgagcacgatagttcagatgaatcg
gaaactatccctgaaaaaacacctcatttgacaacaacaatggttattagtagtgcggtt
aatccgatgatcggaatggaaaatattaccccatatgatttcatgtaa

DBGET integrated database retrieval system