KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03385Help
Entry
MI1_03385         CDS       T01768                                 

Definition
acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lmm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lmm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lmm00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710153..711448
Genome map
AA seq 431 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWLVKVGDTIAADDPVAEVQNDKLMQEILSPYGGKVTKLF
VDAGTTVEVGDPLIEFDGDGSSENDSDNGHVAQPSISSNVVETEQSTPKNTAPKETSTVQ
VANGHVLAMPSVRHLAHEKNIDLTQVPATGRHGHVTLADVENFQGSDNSAPTQTQTSTTS
QTESSAAVHEEPAPALPLREGRQPMAPVRKAIARAMDRQAAIPTVTNFDSVDVRKLVCHR
KAFKEMARDDKGIRLTYLAYAVKALAAVAKKFPELNASVDMKAQEIVYHDDVNMGIAVDA
PAGLFVPVIKNADRKSIFTIAQEITDLAEAVRDGSITPAQMQGGTITISNLGSARGTWFT
PIINGKEVAILGLGSILKEPIVNDDGELAVGQNMKLSLTYDHRLIDGMLGQSALNYLKQL
LSDPAYMLMEV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaagatgccagatattggcgaaggtatggcggagggagatattact
tcttggctggttaaagttggtgatacgatagcggctgatgatccagtcgcagaagtacaa
aatgataaattgatgcaagaaattttgtctccgtatggtggcaaagttacaaaacttttt
gttgatgccggaacaacagttgaggttggcgatccattaattgagtttgatggagacggc
agcagtgaaaatgactctgataacggtcatgtagcgcaaccaagtatttcttcgaacgta
gtggagacagagcaaagcaccccaaaaaacacagctcctaaggaaactagcactgttcaa
gtagcaaacggtcatgtgctggcaatgccatcagtacgtcatttggctcatgagaaaaat
atagatttaacacaagtaccagctactggtcgccatggtcatgttacattagcagacgtt
gaaaatttccagggatcagacaattcagcacccactcaaacgcaaacatcaaccacatct
caaacagagtcgtctgcagctgttcatgaggaaccagcaccagcattaccattgcgtgaa
gggcgtcaaccaatggcaccagtacgtaaagcgatagctagagcgatggataggcaagca
gctattccaacagtaacgaattttgattctgttgatgttagaaaattggtttgccaccgt
aaggcgtttaaggaaatggctcgagatgacaaaggcatacgtttaacatatctagcctat
gctgttaaagcgttggcagctgtagctaagaaattcccagaattaaatgctagtgttgac
atgaaggcgcaagaaattgtttatcacgatgatgttaacatgggtatcgctgtggatgcg
ccagctgggttgtttgtgccagtcattaagaatgcagatcgaaagtctattttcacaatt
gcgcaagaaataactgatcttgctgaagcagttcgtgatggatcaattacacctgcccaa
atgcagggcggaacaatcacaatttctaaccttggttcggcccgaggtacttggtttaca
ccaattattaacggtaaagaagtagcaatattgggattaggttcgatcttaaaggaaccg
attgtcaatgacgatggagagctagccgtgggccaaaacatgaaattatcattgacctat
gatcatcgtttgattgatggcatgctagggcaatcggcccttaattatttgaagcagcta
ttgtctgacccagcctatatgttgatggaggtgtaa

DBGET integrated database retrieval system