KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03470Help
Entry
MI1_03470         CDS       T01768                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lmm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730222..730719
Genome map
AA seq 165 aa AA seqDB search
MTKIKMVWAEDRQHAIGKDGGIPWHMPDDLKLFRDETVNTLMIMGRPTWLSIGRPLPKRT
SVVMTRQEDWTPSYPEVKVIHSIEEAKNLIAKEERDITIAGGAAVYREFMPYATDLVITR
VDGVIDGDTFVDEVDLTQFQLKSSEPHAKDDNHDYAFVVERYERI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaattaaaatggtatgggctgaagatcgtcaacatgcaattggaaaagatggt
ggtataccttggcatatgcctgatgatctcaaactgtttagagatgaaacagtcaatacc
ctaatgattatggggcgcccaacgtggcttagcattgggcggccattgcctaaacgaaca
tctgtagttatgactaggcaagaagactggacaccaagttatccagaagtaaaagttatt
cattccattgaagaagccaaaaatttgatagctaaggaagagcgagatattacgattgct
ggtggcgcagcagtttaccgtgaatttatgccctatgcaacagatttagttataacgcga
gttgacggtgtgattgatggcgatacttttgttgatgaggtggatttaacacaatttcaa
ctaaagtccagtgaaccacatgcgaaagatgataatcatgattacgcattcgttgtcgaa
cgctacgaacgcatataa

DBGET integrated database retrieval system