KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03620Help
Entry
MI1_03620         CDS       T01768                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MI1_03620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MI1_03620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MI1_03620
Enzymes [BR:lmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MI1_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758731..760188
Genome map
AA seq 485 aa AA seqDB search
MNYVSTRGQAPAVTSSQAIINGIAPDGGLYVPEKWPKLKLDWKNLSQQSYQEIATQVFDA
FFDDFTVQEIDHIISKSYGNQWDAESIVTLHNENKLHYIELFHGPTLAFKDVALQALPHL
LTTAAKKQSLNDKIVILTATSGDTGTAAMSGFANVENTEIVVFYPEVGVSDIQRQQMQTE
EGHNAHVTAITGNFDDAQKAVKSILSDEELIQELSEKGMRFSSANSINIGRLVPQIVYYI
YAYAQLVKNDVVVPGEEINIDVPTGNFGNVLASYYASQLGLPVHQFTVASDENNVLTDFF
NTGIYDRQRDFKVTNSPAMDILVSSNLERLLYFASGRNDEEVRQYMKSLAENGQYTLTDK
TRNYLQKFTAKFATQSQVVDTIKDVFENSGYLIDPHTAVGRFAYEEETHQTLLAATASPY
KFPQTVLAALQEKNEGGVVDLQKLAERTNTVIPAQVATLFDKTIVHTKIIEPAMIMQSIK
DELSI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtatcaacacgtggacaggcgcctgcagttacatctagccaagcaataata
aacggtattgcgccagatggcggtctttacgttccagaaaaatggccaaaattaaaatta
gattggaaaaatctaagccagcaaagctatcaagaaattgccacgcaagtatttgatgcc
ttttttgatgattttacagttcaggaaattgaccatattatttcaaaatcatatggcaat
caatgggatgctgagagcattgtgaccttgcacaatgaaaacaagttgcactatattgaa
ttgtttcatggaccaaccttagcattcaaagatgttgcactacaggcactaccacatcta
ttaacgacagctgctaaaaagcagtcactaaatgataaaattgttattttaacagctaca
tctggcgatacaggaactgctgctatgagcggctttgcaaatgttgaaaatactgaaata
gttgttttttacccagaagttggtgttagtgatattcagcgtcaacagatgcaaactgaa
gagggacacaatgctcatgttacagcaataactggtaattttgatgatgcccaaaaagct
gtaaaatctattttgagcgatgaggaattaattcaggaattatcagaaaagggtatgcgt
ttttcatcagctaattcaattaatattggtcgattagtaccacaaattgtgtattacatt
tatgcttacgcccaattagtaaaaaatgatgtggtggtaccaggagaagaaatcaatatt
gatgtgccaaccggaaactttggtaatgtgcttgcttcatattatgccagtcagttagga
ttaccagttcatcagtttacagttgcttcggatgaaaataatgtattaactgattttttc
aacactggtatctatgatcgtcaacgtgattttaaagtcacaaattcaccggcaatggat
atcttagtatcaagcaacttggaacggttgttgtattttgctagtggtcgtaatgatgaa
gaagttcgccagtatatgaagtcattagctgaaaatggtcaatataccttgactgataaa
acgcgtaattatttgcaaaaattcacagctaaatttgcgacacaatctcaagtggttgat
acgattaaagatgtctttgaaaatagcggttacttaattgatccgcatacggctgttggt
cgctttgcttacgaagaagaaacacatcaaacgttacttgcagcaacagcaagtccttat
aagtttccacaaacagttttggcagcattgcaggaaaaaaacgaagggggcgtagtggat
ttgcaaaagctagctgaacgaacaaatacagttattccagcacaagtagcaacgttattt
gataaaactattgtacacactaaaatcatcgagcctgcgatgattatgcaatctattaaa
gacgaactatctatatga

DBGET integrated database retrieval system