KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03655Help
Entry
MI1_03655         CDS       T01768                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MI1_03655
Enzymes [BR:lmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MI1_03655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(766030..766971)
Genome map
AA seq 313 aa AA seqDB search
MKNKVVVIGSLNIDTIQMIDRLPNQGETITVNNQASTFGGKGANQAVAAARQGADVTMIG
AVGDDDRGRAFKQLLSDEGISTDYIFTKSQFTGSATIMLEPDGHNTIMVYGGANMNLTSA
DVEKARNIIANADVIVAQLEVPTEAIVAGFNIAKENGVLTILNPAPITSHLDSNIISSTD
LIIPNETEAAALAHTEPTTKQSSLTPLTSKLNKVGFSNVVVTLGSDGVYYHVNGSADILP
VFKVNAVDTTAAGDTFIGTFSANIDDNLSNLPSVIRRSCFASSIAVSRSGAIASIPNKKD
VDAGLLANAAMAE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaggttgttgttatcggtagtctcaatattgatactattcaaatgattgat
agattaccaaaccaaggagaaaccatcaccgttaacaatcaagcaagtacatttggtggt
aaaggcgccaatcaggcagttgcagctgctcgtcaaggagctgatgtaacaatgatcggt
gctgtaggtgatgatgaccgtggacgtgccttcaaacaattattaagtgatgaaggaata
tcaacggattatatttttacaaagagccagtttactggttccgccactataatgttggag
ccagatggacataacacgattatggtatatggtggcgcaaatatgaatttaaccagcgcc
gatgtggaaaaagcgcgcaatataattgctaatgctgatgtaatcgtagcacagcttgaa
gtacctactgaagccattgttgctgggtttaatatcgccaaggaaaatggcgtactaact
atattaaatccggcacctattacgtcacatcttgattcaaatattatttcatctactgat
ttaatcataccaaacgaaactgaagccgcggcactagctcacactgagccaaccacaaaa
caatcgtcgttaacgccactcacttccaaattaaataaagtaggtttttccaacgtagtg
gttacacttggcagtgatggtgtttactatcatgtcaatgggtcggcagatattttacct
gttttcaaggtaaatgccgttgataccactgctgctggtgacacattcattggtactttt
tcagctaatattgacgacaacttgtcgaatctaccaagcgtcattcgacgtagttgcttt
gctagttcaatagccgtcagccgatctggtgcaatagcctcgattccaaataaaaaagac
gttgacgctggtttgcttgctaatgctgctatggcggaatga

DBGET integrated database retrieval system