KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03915Help
Entry
MI1_03915         CDS       T01768                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MI1_03915
Enzymes [BR:lmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MI1_03915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826878..828899
Genome map
AA seq 673 aa AA seqDB search
MNKNKELLFGVAYYFEYLPYDRIDQDIKMMQEAKINVVRIGESTWSTYEPQDGVFDFSKL
IYTLNKMRDAKISVIVGTPTYAFPTWLARKFPEVLVENNGNRLPYGARQIMDITSPIYRY
YSERIIRHMLQETVDYENIIGYQVDNETKHYGTSASHVQAGFVEEIKEKFSGDLDTFNKE
FGLDYWSNRINTWEDFPNVNGTINGSLAGEFAKYQRSLVKEYLSWQVDLVNEYKKDFQFV
THNFDFEWRDYSYGIQPDVNHFEAAEPLDFVGIDVYHPSQSQLTGTENSFAGDVARSIKH
QNYLVLETQAQAFKSWTPFPGQLYQLAFNHIANGANMIEYWHWHSIHNSFETYWKGLLSH
DFEPNPVYEEAQKVGHDFERLSDKLVNLNHAADVAFVVDNESLTATSSDWIEFAIGKDVN
YNDVFRRLYDTFYKLNVRTDILNPKTINLSDYALVVVPMLYVSDETFLKALNQYIHDGGN
VLFTFKDGVTDEHVKVRTDIQPAIIREAVGAHYHMFVDPNGETLEDQTGIFEDTDLHISE
WAELLESDGATILASYNNHWKKFGAITENKYGNGMAWYLGAWPSQSVTNALIKHVINQSG
ISQSDYDVTFPVIVKSAKNEYGANIDFLFNFSDTSTSLATPFSGMELIKQEHMAQGSQVT
LQPWDVKIIERSN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaataaggaattattgtttggcgttgcctattattttgagtatttgccctac
gatcgtattgatcaagatatcaaaatgatgcaagaagctaaaattaatgtcgtcagaatt
ggagaaagtacttggagtacctacgaaccacaagatggtgtatttgattttagcaaactg
atttatacgctaaataaaatgagggatgcaaagatatcggttattgtgggcacgccgacg
tatgcatttcctacttggttggctaggaagtttcctgaggtgcttgttgaaaataacgga
aaccggctaccttatggtgccaggcagataatggatattaccagtccgatttatcgatat
tattctgagcgaatcattcgtcatatgttgcaggaaacggttgattacgagaatatcatt
ggctatcaagtcgataatgaaactaagcactatggtacatctgcaagtcacgtacaggcc
ggttttgttgaagaaattaaagaaaaattttctggtgatcttgatacattcaataaagag
tttggtcttgactattggtcgaatcgtattaacacatgggaggactttccgaatgtaaac
ggtacaattaacggcagtttagcaggtgagtttgcaaaataccaacgttcattagtgaag
gaatacttaagttggcaagttgacttggtcaatgagtataaaaaagattttcaatttgta
acacacaattttgattttgaatggcgtgattattcgtatggcattcaaccagatgtcaat
cattttgaagcagctgaaccgttagactttgtgggaattgacgtctatcatccctcacaa
agtcagcttacagggacagaaaattcttttgctggcgatgttgcgcgttcaattaagcat
caaaattatttggtgctagaaacgcaggcacaagcatttaaaagctggacaccatttcca
ggacaactttatcaacttgcttttaaccatatcgccaatggcgcgaacatgattgaatat
tggcactggcattctattcataattctttcgagacgtattggaaaggattactgagtcat
gattttgaaccaaatccagtttatgaagaggctcaaaaagtgggacatgactttgaacgt
ttgtctgataagttagtcaacttaaatcatgcagcagacgtagcgtttgtggtagataac
gaaagtctcacagcaacatctagtgattggatagagtttgcgattggaaaagacgtaaac
tacaatgatgtatttcgaagattgtacgatacattttacaaattaaatgtccgaaccgat
attttgaatccaaagacaattaatttgagtgattacgcattagttgtcgtaccaatgtta
tatgtcagtgacgaaacctttttgaaagcgttaaatcagtacattcatgacggtggcaat
gtattgttcacgtttaaagacggtgtgactgatgaacatgtcaaagtgcggactgatata
caaccagcaattattcgagaagcagttggtgcgcattatcacatgtttgtcgaccccaac
ggtgagacattagaagatcaaactggcatatttgaagatactgatttgcacatcagtgag
tgggctgaattgctcgagagtgacggagcaacaattttagcctcatataataatcattgg
aaaaaatttggtgctattacagaaaacaaatatggtaatggtatggcatggtatttaggt
gcttggccaagccagtctgttacgaatgctctaataaagcatgttatcaatcaatcagga
atttcccaatctgattatgatgtaacttttccagtgattgttaaatcagcaaaaaatgag
tacggcgcgaacattgattttctgttcaatttttcggatacgagtacaagccttgctacg
cctttctcaggtatggagctaatcaaacaagaacacatggctcaaggtagtcaagtgaca
ttgcaaccttgggatgtaaaaattatagaaagaagtaactga

DBGET integrated database retrieval system