KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_04095Help
Entry
MI1_04095         CDS       T01768                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MI1_04095
  Lipid metabolism
   00561 Glycerolipid metabolism
    MI1_04095
   00600 Sphingolipid metabolism
    MI1_04095
Enzymes [BR:lmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MI1_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870266..872488
Genome map
AA seq 740 aa AA seqDB search
MANANISFDDKQNVFHLSNRQISYLIQIEEGGLLSHLYFGKKITKYHGSRHYPRLDRGFS
PNLAGEPHQTDRSYSKDTLLQEYGGYNTGDFRQAAIKIQGANGAQASDFRFQSFKIVNGK
PHLDRLPQAYVLSEDEAKTLIINLVDSTLNAQVSLYYTIYNDRPVVARSTKITNLSQQSI
NIEKIASMQLDLPASDLEIISLPGAHVRERQMERQIVRQGVTEFSSHRGTSSHHMNPFVV
LVTPNTTENEGEAVGVQLVYSGNHQFTIERDYVEQTRVLSGINEDGFDWQLNADDDFQTP
EALLVYSDEGLNGMSQAYHHLLRERVARGKYQYAERPIVINNWEATYFDFNAEKIQEILD
EASPLGIEMFVLDDGWFGKRDDDDSSLGDWFEYATKLQSGGGLVGLSDKVHEKGMKFGLW
FEPEMISKNSDLYRQHPDYILGMPNRDLTPSRDQYVLDFSRPEVVDNIFQQVVNILDNVK
IDYIKWDMNRHLTEVYSAALSPERQGEVGHRYMLGVYDLADRLTKRYPDILFEGCSGGGG
RFDAGMLYFFPQSWTSDNTDPVERLKIQYGTTLSYPVSSMTAHVSASPNHQTGRQTSLAM
RGDVATAGVFGYELNLAKLSLEEKSEIKDQVTFYKQHRSLIQYGNFYRIKSPFKNNETAW
EFISEDKTEVLLFNYRVLSTAQPVFTVTKMSHLKSDGIYVDQRTDEHYSGDELMSIGLYN
TPIKQADFTSAVRYFKWQAE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgcaaacatttcttttgatgacaagcaaaatgtttttcatctttcaaatcga
caaatatcttacctgatacaaattgaagagggcggactgctaagccatctctattttggt
aaaaaaattacaaaatatcatggttcacgacattatccacgtctagatagaggattctca
ccaaacttagctggagaaccacatcaaacagatcgtagctattcgaaggacacattatta
caagaatacggtggttataatacgggagattttcgtcaagccgcgattaaaattcaagga
gccaacggtgcacaagcatctgattttcgttttcaatcattcaaaattgtaaatggcaag
ccacatctagatcgtctgcctcaggcctacgtgttatctgaagatgaagctaaaacatta
ataattaatcttgtggatagtacgctaaatgcccaagtatcactttattacacaatttat
aatgaccggccagtagttgcaagatcaactaaaataacgaatctctctcaacaaagtatt
aatattgagaaaattgcatcaatgcaattagatttaccagcaagtgatctagaaatcatc
tcgttacccggcgcccatgtgcgtgaacgtcaaatggagcgacaaattgtgcgccaaggg
gtgactgaattttctagtcatcgaggaacgagctcgcaccacatgaatccatttgtagtg
ctagtaacaccgaacacaaccgaaaatgagggtgaagctgttggtgtccaactggtttat
tcgggaaatcatcaattcactatcgaaagagattatgtggaacagacacgtgttctatct
ggtattaacgaagatggatttgattggcaattaaatgctgatgatgactttcagacacct
gaagcgttgttggtttattctgatgaaggtttaaatggtatgtcacaagcttaccatcac
ttgctacgagaacgtgtggctcgtggaaaatatcaatatgcagagagaccaattgttatt
aataactgggaagcaacttattttgattttaatgcagaaaaaattcaagagatattagat
gaagcatccccattaggcattgaaatgtttgtcttagatgatggttggtttggaaaacgt
gatgatgatgatagttctttgggtgactggtttgaatacgctactaaattacagagtggc
ggtggtttagttggcttgtcagataaagtacacgaaaaaggtatgaaatttggattatgg
tttgaaccggaaatgatttccaaaaattctgatctctatcgacaacatcctgattatatt
ctcggtatgcctaaccgtgatttgacccctagtcgtgatcaatatgtgcttgatttttca
agacctgaggtagtggataatattttccaacaagtagtaaatatcttggataatgttaag
attgattacattaagtgggacatgaaccgtcatttaacagaagtatattctgcagcgttg
tcaccagaacgtcaaggagaagtgggacatcgttatatgttaggtgtgtatgatttggcg
gatcgtttgaccaaacgttatccagatattttatttgaaggatgctctggcggtggcgga
cgatttgacgctggcatgttatatttctttccacaatcgtggacatcagacaatacggac
cctgttgagcgcttaaaaattcaatatgggacgacattaagctacccagtctctagtatg
accgcgcatgtttcagcatcgcctaatcatcaaactgggcgtcaaacgagtctggctatg
cgtggggatgttgctactgcaggagtctttggatatgaattaaacctagctaagttgtca
ttagaagaaaaatcagaaatcaaagatcaagtgacattttataaacagcatcgctcgttg
atccagtatggcaatttctaccgtatcaaaagtccttttaaaaataatgaaacagcctgg
gaatttatcagtgaagataagacagaagtattgttattcaattaccgtgttttgtcaact
gcgcagccagttttcactgtaactaaaatgagtcacctgaaatctgacggaatctatgtt
gatcaaagaacagatgaacattattctggagatgaactcatgtcaattggtctatataac
acgccaattaagcaagctgattttacatctgcggtgcgttatttcaaatggcaagctgaa
taa

DBGET integrated database retrieval system