KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05180Help
Entry
MI1_05180         CDS       T01768                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lmm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lmm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1085880..1086656)
Genome map
AA seq 258 aa AA seqDB search
MTRISQALENKNAFIGFAVAGYPDFEKSAKYIVDMAEAGADLIEIGIAFSDPSADGPTIM
NADQEVLENGSTTADVFNLVAEVRKHTDVPLVFLTYTNPVFKYGYEKFLSKMQSLDIQGV
IMPDMPMEEQDEFLELVHQYGRDFIQLVTLQSGNRLPKIVERASGFIYVVSSLGITGSRS
KLSNEADEIVTKIKRLTDLPVAVGFGITTYDQAKQFESADAIIVGSALVKIIEDHPEDAT
SYLTDFIKNMKGAHHAKN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactagaatttcacaggcattagaaaataaaaatgcttttattggtttcgcggtagct
gggtatccagattttgaaaagagtgcaaaatatattgttgatatggctgaggctggtgca
gatcttattgagattggcattgcttttagtgatccaagtgctgacggtcccactatcatg
aatgctgatcaagaggttctcgaaaacggttcaacaacagctgatgtgtttaatttagtt
gctgaagttcgcaaacacacggatgtgcctttagtttttctaacgtatacaaatccagta
tttaaatatgggtacgaaaaatttctcagcaaaatgcagtcgttggatattcagggtgtt
attatgcccgacatgcctatggaagaacaagatgaatttttggaacttgtccaccagtat
ggtcgcgactttattcaactcgtaacattacaatccggaaatcgtttgccgaaaattgta
gaacgtgcttctggatttatatatgtagtaagttccttaggaatcacaggctctagaagt
aaattgtcaaacgaagctgatgaaatcgttactaagattaagcggctaacagatttgcca
gttgcagttggttttggcatcacgacatatgatcaagcaaaacaatttgaatctgctgat
gcgattattgttggctcagcacttgtcaaaattatcgaagaccacccagaggatgctaca
tcttatttgacagattttattaaaaacatgaaaggagcgcatcatgcgaaaaattaa

DBGET integrated database retrieval system