KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05180Help
Entry
MI1_05180         CDS       T01768                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MI1_05180
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MI1_05180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MI1_05180
Enzymes [BR:lmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MI1_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1085880..1086656)
Genome map
AA seq 258 aa AA seqDB search
MTRISQALENKNAFIGFAVAGYPDFEKSAKYIVDMAEAGADLIEIGIAFSDPSADGPTIM
NADQEVLENGSTTADVFNLVAEVRKHTDVPLVFLTYTNPVFKYGYEKFLSKMQSLDIQGV
IMPDMPMEEQDEFLELVHQYGRDFIQLVTLQSGNRLPKIVERASGFIYVVSSLGITGSRS
KLSNEADEIVTKIKRLTDLPVAVGFGITTYDQAKQFESADAIIVGSALVKIIEDHPEDAT
SYLTDFIKNMKGAHHAKN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactagaatttcacaggcattagaaaataaaaatgcttttattggtttcgcggtagct
gggtatccagattttgaaaagagtgcaaaatatattgttgatatggctgaggctggtgca
gatcttattgagattggcattgcttttagtgatccaagtgctgacggtcccactatcatg
aatgctgatcaagaggttctcgaaaacggttcaacaacagctgatgtgtttaatttagtt
gctgaagttcgcaaacacacggatgtgcctttagtttttctaacgtatacaaatccagta
tttaaatatgggtacgaaaaatttctcagcaaaatgcagtcgttggatattcagggtgtt
attatgcccgacatgcctatggaagaacaagatgaatttttggaacttgtccaccagtat
ggtcgcgactttattcaactcgtaacattacaatccggaaatcgtttgccgaaaattgta
gaacgtgcttctggatttatatatgtagtaagttccttaggaatcacaggctctagaagt
aaattgtcaaacgaagctgatgaaatcgttactaagattaagcggctaacagatttgcca
gttgcagttggttttggcatcacgacatatgatcaagcaaaacaatttgaatctgctgat
gcgattattgttggctcagcacttgtcaaaattatcgaagaccacccagaggatgctaca
tcttatttgacagattttattaaaaacatgaaaggagcgcatcatgcgaaaaattaa

DBGET integrated database retrieval system