KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05190Help
Entry
MI1_05190         CDS       T01768                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MI1_05190
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MI1_05190
Enzymes [BR:lmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MI1_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1087225..1088013)
Genome map
AA seq 262 aa AA seqDB search
MILDDLVAATRQNMLARQAQKSLHDLQKEAAHITVSREFPFEKSLAQQKISVIAEIKQAS
PSKGQIVPSSEFDYQGIAKDYEVAGVDAISVLTEENYFKGSLDILKTVAADSATPVLRKD
FTIDPYLIYEAKVAGSQIILLIVAILTDEQLKEYLSLANELGLSVIVEAHNEEEILRAVK
ANARIIGVNNRNLKDFTVDFDNTKRLRQLVPPEILFISESGIKDRSDVVTLEQIGVDGIL
VGETFMKATDKLAAIQQLRGEK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgatttagtagcagcaacacgtcaaaatatgttggcgcgtcaagctcaa
aaatcgctgcatgacttacaaaaagaagcagcacacatcacagtttcaagagaatttcct
ttcgaaaaaagtctagctcaacagaaaatatcagttattgccgaaattaaacaagcatcc
ccatcgaaagggcaaattgtaccttcatcagagtttgattatcaagggatcgcgaaagac
tatgaggtggcaggtgtcgatgcgataagcgttttgacagaagagaattatttcaaggga
tctcttgatattttaaaaacagttgcagcagattctgctactcctgtattacgcaaagat
tttacaattgatccatacctgatttatgaggctaaagtagctggatcacaaatcatttta
ttaatcgttgctattttaacggacgaacaattaaaagaatacctatctttagcaaacgaa
ttaggattgtcagtaattgtggaagcgcacaatgaagaagagattctccgagcagtgaag
gcaaatgcacgaattattggtgtgaacaatcgtaatttaaaagacttcacggtcgacttt
gacaacactaaacgtttacgacaattagttccaccagaaattttatttatttcagaatct
ggtataaaagatcgctcagatgttgttacccttgaacagattggcgtggacggtatttta
gttggtgagacgttcatgaaggctacagataaattagcggccatacaacagttaaggggc
gaaaaatga

DBGET integrated database retrieval system