KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05200Help
Entry
MI1_05200         CDS       T01768                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MI1_05200
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MI1_05200
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MI1_05200
Enzymes [BR:lmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MI1_05200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1089028..1090215)
Genome map
AA seq 395 aa AA seqDB search
MTRKGYYGEYGGQFVPELLMPAINEVTEAFNKYKEDPAFKSELKDLFDNYANRPSMLYYA
KNMSEDLGGAQIYLKREDLNHTGAHKINNVLGQALIAKKMGKTRLIAETGAGQHGVATAT
AAALFGMEAEIFMGKEDTERQALNVYRMELLGAKVHAVTTGTQVLKDAVNATFQDWTKRI
DDTFYVLGSAVGPYPFPEMVKYFQSVISEEARRQFLEMTGKLPDAVIAAVGGGSNAIGAF
AKFIDDAEVELIGVEAAGKGVKTDQTAATMALGSKGVFHGMKSQFLQSADGQIDPVYSIS
AGLDYPGIGPEHVYLKDIHRATYVPITDDEAVDAFEYIAKTEGVIAAIESAHAVAYAMKL
APKMRKDQQIMVNLSGRGDKDVAAIARYKGVDIHE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaaaggttattacggagaatatgggggacaatttgttccagaattgctaatg
ccagcaattaatgaagtcacagaggcattcaataaatataaagaggatccggcttttaaa
agtgaattgaaagatttattcgacaattacgcgaaccgaccatctatgttatattatgca
aaaaatatgtctgaagacttaggtggtgcgcaaatttatctaaagagagaagatttaaat
cacactggtgctcataaaattaacaatgttttagggcaagcattaattgccaaaaaaatg
ggtaaaacacgtttaattgctgaaacaggtgccggacaacatggcgtggcaacagctacg
gctgcggcattgtttggtatggaagcagaaatttttatgggcaaggaggatacagaacga
caggcgttgaatgtttatcgcatggagctactaggggccaaagttcatgcggtgacaaca
ggaacacaagtcttaaaagatgcggtgaacgcaacatttcaagattggacaaaaagaatt
gatgatactttctatgtacttggttcagcggttggtccatatcccttcccagaaatggtt
aaatatttccaatcagttataagtgaggaagccagaaggcaattcttagaaatgactgga
aaactgccagacgctgtaattgctgccgttggtggtggatcgaatgcaattggtgctttc
gctaagttcattgatgacgcagaagtggaattgattggcgttgaagccgctggaaaaggc
gtaaaaactgatcaaacagctgcaaccatggcactaggttcaaaaggtgtttttcatggt
atgaaatcccaatttttacaatcagccgatgggcaaattgatcctgtttacagtatttct
gcaggattggactatcctggcatcggaccggaacatgtttatctaaaggatattcaccga
gcaacttatgtaccgattacagatgatgaagcagttgatgcatttgaatacattgcaaaa
acagagggtgtaattgctgcaattgaaagcgcacacgcagtagcctatgcaatgaaatta
gcaccaaaaatgagaaaagatcaacaaataatggttaatctgagtggtcgaggtgacaaa
gacgttgctgcgatagcccgttataaaggagttgatattcatgagtaa

DBGET integrated database retrieval system