KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_08130Help
Entry
MI1_08130         CDS       T01768                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00010  Glycolysis / Gluconeogenesis
lmm00260  Glycine, serine and threonine metabolism
lmm00680  Methane metabolism
lmm01100  Metabolic pathways
lmm01110  Biosynthesis of secondary metabolites
lmm01120  Microbial metabolism in diverse environments
lmm01130  Biosynthesis of antibiotics
lmm01200  Carbon metabolism
lmm01230  Biosynthesis of amino acids
Module
lmm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_08130 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MI1_08130 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MI1_08130 (gpmA)
Enzymes [BR:lmm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MI1_08130 (gpmA)
Membrane trafficking [BR:lmm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MI1_08130 (gpmA)
Exosome [BR:lmm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MI1_08130 (gpmA)
  Exosomal proteins of melanoma cells
   MI1_08130 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sortase
Motif
Other DBs
NCBI-ProteinID: AET31068
Position
complement(1703792..1704505)
Genome map
AA seq 237 aa AA seqDB search
MAKLVLIRHGQSEWNALNLFNGWIDTKLSEKGIAQAKEAGDLLAAEGIQFDQAYTSVLTR
AIQTLHLALEEAGQLFIPEAKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDVL
PPLLDSYDETMTVQGNTYPAFDRRYADVPEGELPLGENLKITLERVLPFWESDISKDLKA
GKNVVIAAHGNSLRALVKHLENISDDDILNVEIANGQPLVYDLADDLSVVSKKTLTK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttagtattaatccgtcacggtcaaagtgaatggaatgcattaaacttgttt
aatggttggattgacacaaagttgtctgaaaaaggtattgcccaagccaaagaagctggc
gatcttttggctgctgaaggtattcaatttgaccaagcatatacgtcagttttgacgcgt
gcaatccaaacattgcacttggctttagaagaagcaggacaattgtttattccagaagca
aagtcatggcgtttgaatgaacgtcattatggcgcattgcaaggtcaaaacaaagccgaa
gctgctgaaaagtggggtgacgagcaagttcacatctggcgtcgttcatacgacgttttg
ccaccattgttggactcatatgatgaaacaatgacagtacaaggtaatacttacccagca
tttgatcgtcgttacgccgatgtacctgaaggtgaattgccattgggtgaaaacttgaaa
attactttggaacgtgtattgcctttctgggaatcagacatttcaaaagatttaaaagct
ggtaaaaacgtggttattgccgctcacggtaactcattgcgtgccttggttaagcacttg
gaaaacatctcagatgacgacattttgaatgttgaaattgctaacggacaaccattggta
tatgatttggctgatgatttgtcagtcgtatcaaaaaagacattaactaagtaa

DBGET integrated database retrieval system