KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_08130Help
Entry
MI1_08130         CDS       T01768                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MI1_08130
   01230 Biosynthesis of amino acids
    MI1_08130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_08130
  Energy metabolism
   00680 Methane metabolism
    MI1_08130
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MI1_08130
Enzymes [BR:lmm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MI1_08130
Exosome [BR:lmm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MI1_08130
  Exosomal proteins of melanoma cells
   MI1_08130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1699729..1700442)
Genome map
AA seq 237 aa AA seqDB search
MAKLVLIRHGQSEWNALNLFNGWIDTKLSEKGIAQAKEAGDLLAAEGIQFDQAYTSVLTR
AIQTLHLALEEAGQLFIPEAKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDVL
PPLLDSYDETMTVQGNTYPAFDRRYADVPEGELPLGENLKITLERVLPFWESDISKDLKA
GKNVVIAAHGNSLRALVKHLENISDDDILNVEIANGQPLVYDLADDLSVVSKKTLTK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttagtattaatccgtcacggtcaaagtgaatggaatgcattaaacttgttt
aatggttggattgacacaaagttgtctgaaaaaggtattgcccaagccaaagaagctggc
gatcttttggctgctgaaggtattcaatttgaccaagcatatacgtcagttttgacgcgt
gcaatccaaacattgcacttggctttagaagaagcaggacaattgtttattccagaagca
aagtcatggcgtttgaatgaacgtcattatggcgcattgcaaggtcaaaacaaagccgaa
gctgctgaaaagtggggtgacgagcaagttcacatctggcgtcgttcatacgacgttttg
ccaccattgttggactcatatgatgaaacaatgacagtacaaggtaatacttacccagca
tttgatcgtcgttacgccgatgtacctgaaggtgaattgccattgggtgaaaacttgaaa
attactttggaacgtgtattgcctttctgggaatcagacatttcaaaagatttaaaagct
ggtaaaaacgtggttattgccgctcacggtaactcattgcgtgccttggttaagcacttg
gaaaacatctcagatgacgacattttgaatgttgaaattgctaacggacaaccattggta
tatgatttggctgatgatttgtcagtcgtatcaaaaaagacattaactaagtaa

DBGET integrated database retrieval system