KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_08370Help
Entry
MI1_08370         CDS       T01768                                 

Definition
(RefSeq) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MI1_08370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_08370
  Lipid metabolism
   00071 Fatty acid degradation
    MI1_08370
  Amino acid metabolism
   00350 Tyrosine metabolism
    MI1_08370
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MI1_08370
   00626 Naphthalene degradation
    MI1_08370
Enzymes [BR:lmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MI1_08370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1743648..1744700)
Genome map
AA seq 350 aa AA seqDB search
MKAAVVRNVNDGYVDLIEDWQPRALAFGDALVDVEYVGLCHTDLHCANGDFGDPNKIGER
NGNFGRVIGHEGVGRVSKLGEGASDYLKVGDRVSIAWFYDACGVCDYCVSGNETFCRKVR
NSGYTIDGAMSQQVVVNAKYAVKVPEGLDPVEATSITCAGVTMYKALKVGETKPGEWVSV
HGAGGLGNLAVQYAHSVFGAHVAVIDGNDDKLAAAKANGAEVLVNRKKEDVVAKVNELTG
GVHNAQVTAVNDAAFSQAVNVLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGTR
ADLKEAFQFGAEGKVKPIVETVAFQDMNEIIDEMKAGSITGRKVIDFTTL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgttcgtaacgtaaatgatggttatgttgatttgatcgaggattgg
cagccacgtgcgttagcatttggagatgcattggttgatgttgaatacgttggcctttgt
cacactgatttgcactgtgcaaacggcgatttcggtgaccctaacaagatcggtgaacgt
aacggtaattttggtcgagttattggacatgaaggtgttggacgcgtgtctaaattaggc
gaaggtgctagcgattaccttaaagtcggtgaccgtgtttcaattgcctggttctatgac
gcttgtggcgtttgtgattactgtgtctcaggaaacgaaacgttctgccgtaaggtgcgt
aattctggttacacaattgatggcgcaatgtcacaacaagttgttgtaaatgctaagtat
gcggttaaagtaccagaaggtttagaccctgttgaagcgacatcaattacttgtgctggt
gttacaatgtataaagccttgaaagtcggtgaaactaagcctggtgagtgggtgtcagtt
cacggtgctggtggtctaggtaatttggctgttcaatatgcacacagtgttttcggtgct
cacgttgcagttattgatggaaacgatgataaattagcagccgcaaaagctaatggagcg
gaagtactagttaatcgtaagaaggaagatgttgtggctaaggtgaatgaattaactggc
ggcgttcacaatgcccaagtgacagctgttaacgatgctgcattctcccaggctgtgaat
gtacttcgtccaatgggcaagcttgtagccgttgctttgccacaaggtgatatggctttg
aatattgctaaaacagtccttgatggtattgaagttcgcggttcattagttggaacacgt
gcagacctaaaggaagctttccaatttggtgctgaaggaaaagttaagccaattgttgag
acagttgccttccaagatatgaatgaaattattgatgaaatgaaagctggttcaattact
ggtcgtaaggtcattgattttacaacactttaa

DBGET integrated database retrieval system