KEGG   Listeria monocytogenes 08-5578: LM5578_0017Help
Entry
LM5578_0017       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LM5578_0017
Enzymes [BR:lmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LM5578_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15439..17139
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDGLAARIETRVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
KKTLTTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIKEMEQS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRLARFLVAHAVLMSIPGVPAVY
VQSILGSRNDYLGVEATSHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatggtttg
gcagctagaatcgaaacgcgggtacagcaaacgcaacaacgaaagttaacgcgaaaagat
cagtgggacgagaaagatattgttttaattacatatggagaccaatttaaagaggaatcc
aaaaaaacgttaacaacttttaagaaaatgtatgatagttatttaaaatcgacttttgag
gtagttcatttcttgcctttttatccttattcttcggatgatgggttttcggtcatcgat
tataaagcggtgaacccggaacttggtgattgggaagatattaaggagatggaacagtcg
gcgcggttgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtgctgacaccatttcaatttgat
tcaggaaaagtagggcatatttggacgacttttagtgaggatcaaatcgatttaaacttt
gcttctccggaagtgctttacaagatgattgatgttttgatgttctatttagaagaaggt
gcggaatatgtgcgacttgatgcggttggctttatgtggaaagtgccgggaacgagttcg
attcacttagaagagacgcatgaaatcgtgaaattatttagagatttagtagacattgca
gctccggggacgattattattaccgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcaaaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcggaattattccagaagctgagattttggctttagtgaatgatttggag
gaagaaggtgcgctcgtttcttacaagcaaaatccagatggttctaagagtccttatgaa
ataaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgatttgcgactt
gcaagattccttgtggctcatgcagtattgatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattatttaggcgtagaagcaacaagtcacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcagaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system