KEGG   Listeria monocytogenes 08-5578: LM5578_0158Help
Entry
LM5578_0158       CDS       T01157                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164508..165104
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatagatagttttatgaaattaccaggaatt
ggaccaaaatcggcagctcggctagcattttatgtgttagatatgaaagaagacgatgtg
ctagattttgcaaaagcacttgttgatgcgaagagaaacctaagcttttgttccgtttgt
ggtcacattacagataaggatccatgttatatttgtgctgatacgtcacgcgatcgaagt
gttatttgtgtggtacaagaatccaaagatgtcattgcaatggaaaaaatgcgtgatttt
catggcttataccacgtgcttcatggcacaatttctccaatggacggaattggaccagaa
gatattaatattcctgatttgctgaaacgtttgcaagatgacactattgaagaagttatt
ttagcaacaaatccaaatgttgaaggagaagccactgcgatgtatatttcgcgtttacta
aaaccttcaggcataaaagtaacgagaatagcgcatggccttccagtgggtggagactta
gaatatgcggatgaagtgacgctttcaaaagcaatggaaggacgaagagaagtctaa

DBGET integrated database retrieval system