KEGG   Listeria monocytogenes 08-5578: LM5578_0381Help
Entry
LM5578_0381       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00010  Glycolysis / Gluconeogenesis
lmn00051  Fructose and mannose metabolism
lmn00562  Inositol phosphate metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
lmn01130  Biosynthesis of antibiotics
lmn01200  Carbon metabolism
lmn01230  Biosynthesis of amino acids
Module
lmn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5578_0381
   00051 Fructose and mannose metabolism
    LM5578_0381
   00562 Inositol phosphate metabolism
    LM5578_0381
Enzymes [BR:lmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LM5578_0381
Exosome [BR:lmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LM5578_0381
  Exosomal proteins of bladder cancer cells
   LM5578_0381
  Exosomal proteins of melanoma cells
   LM5578_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADB67137
Position
complement(390897..391661)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatctaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatcaaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaagcaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaagctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system