KEGG   Listeria monocytogenes 08-5578: LM5578_0461Help
Entry
LM5578_0461       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K02770  
PTS system, fructose-specific IIC component
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LM5578_0461
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    LM5578_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462054..463160
Genome map
AA seq 368 aa AA seqDB search
MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITDIWDAKYADSANSLIS
LLHSLDGFGGLALGMMFPVIAAFIGYSISDKLALAPGLVGGLLARDIGAGFLGALAAGLI
AGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVVGIPFADLNTALENWLNG
MSGSNQIMMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIYAPNTAAQVAIIIPPLGLG
LATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESPLKVIPATVLGSAVGGALAV
GLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMSVALRKASAGEEMAGSSYDDE
IDEAEWEA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaaaattgggagtgaactgaaaaaacacgttttaacaggtatttcatatatg
attccgctcgttattgcaggtgccgtaattatggcgattgctcgggttggtggttcattt
ttcggaattacagatatttgggatgcgaaatacgcagacagtgcgaatagtttaatttca
ctactgcatagtttagatggttttggtggattggcgctaggaatgatgttcccggttatt
gcagcatttatcggatattccatttcggacaaattagcactagcacctggtcttgttggt
ggtttgctggcacgtgacattggcgctggtttcctcggggcacttgcagctggtttaatc
gctggttacacatgtctattgattaaaaaatacgtgaaactgccaaaagcggcggcttca
attgtaccagtatttttagtaccagtttttggcacacttattaccgttcttattattaat
tatgtggttggtattccttttgcagatttaaatacagcccttgaaaattggctaaatggt
atgtctggatcgaaccagattatgatggcggctattatcggcgcgatggttggttttgac
ttaggcggacctgtaaataaagcagctgtaacaacggccatggcacttttaacaagtgga
atttatgcaccaaacacagcagctcaagtagcaatcatcattccaccacttggtcttggt
ttagctacattaatcgcaaaacgtaaatataacactgaaatgcgtgaggcaggaaaatct
tctcttatcatgggacttgttgggattagcgaaggggcgattcctttcgcggtagaatct
ccgcttaaagttattccggctacggttcttggttctgctgtcggcggcgcgctagctgta
ggtcttggcgcaattaaccaagcgccaattagtggtttttatggctggttcacagtagaa
aattggccagtttatattttagcgattgcagttgggacgctaatcgttgcgggtatgtca
gtcgctttacgtaaagcaagtgcaggcgaagaaatggctggttcaagctatgatgacgaa
attgacgaagcagaatgggaagcttaa

DBGET integrated database retrieval system