KEGG   Listeria monocytogenes 08-5578: LM5578_0461Help
Entry
LM5578_0461       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K02770  
PTS system, fructose-specific IIC component
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lmn00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:lmn02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462054..463160
Genome map
AA seq 368 aa AA seqDB search
MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITDIWDAKYADSANSLIS
LLHSLDGFGGLALGMMFPVIAAFIGYSISDKLALAPGLVGGLLARDIGAGFLGALAAGLI
AGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVVGIPFADLNTALENWLNG
MSGSNQIMMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIYAPNTAAQVAIIIPPLGLG
LATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESPLKVIPATVLGSAVGGALAV
GLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMSVALRKASAGEEMAGSSYDDE
IDEAEWEA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaaaattgggagtgaactgaaaaaacacgttttaacaggtatttcatatatg
attccgctcgttattgcaggtgccgtaattatggcgattgctcgggttggtggttcattt
ttcggaattacagatatttgggatgcgaaatacgcagacagtgcgaatagtttaatttca
ctactgcatagtttagatggttttggtggattggcgctaggaatgatgttcccggttatt
gcagcatttatcggatattccatttcggacaaattagcactagcacctggtcttgttggt
ggtttgctggcacgtgacattggcgctggtttcctcggggcacttgcagctggtttaatc
gctggttacacatgtctattgattaaaaaatacgtgaaactgccaaaagcggcggcttca
attgtaccagtatttttagtaccagtttttggcacacttattaccgttcttattattaat
tatgtggttggtattccttttgcagatttaaatacagcccttgaaaattggctaaatggt
atgtctggatcgaaccagattatgatggcggctattatcggcgcgatggttggttttgac
ttaggcggacctgtaaataaagcagctgtaacaacggccatggcacttttaacaagtgga
atttatgcaccaaacacagcagctcaagtagcaatcatcattccaccacttggtcttggt
ttagctacattaatcgcaaaacgtaaatataacactgaaatgcgtgaggcaggaaaatct
tctcttatcatgggacttgttgggattagcgaaggggcgattcctttcgcggtagaatct
ccgcttaaagttattccggctacggttcttggttctgctgtcggcggcgcgctagctgta
ggtcttggcgcaattaaccaagcgccaattagtggtttttatggctggttcacagtagaa
aattggccagtttatattttagcgattgcagttgggacgctaatcgttgcgggtatgtca
gtcgctttacgtaaagcaagtgcaggcgaagaaatggctggttcaagctatgatgacgaa
attgacgaagcagaatgggaagcttaa

DBGET integrated database retrieval system