KEGG   Listeria monocytogenes 08-5578: LM5578_0521Help
Entry
LM5578_0521       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LM5578_0521
   01230 Biosynthesis of amino acids
    LM5578_0521
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LM5578_0521
   00051 Fructose and mannose metabolism
    LM5578_0521
Enzymes [BR:lmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LM5578_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529120..529569
Genome map
AA seq 149 aa AA seqDB search
MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEYAAKVGHFVATENSLG
VLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLD
TWLVAEFEGGRHNTRLQKLAELEEQEEDK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgcaattgcagctgatcatggcggatttcagttaaaagaaaaaatccgtgcg
catttaattgaaagcggctacacagtaaaagattttggttgttattcgttagagagcgtc
gattttccagagtatgctgctaaagtaggacactttgttgcaactgaaaacagtttaggt
gtgctctgttgcggaacagggattggaatgtctatggcagccaacaaaataaaaggtgtg
cgtgctgctgtcgtttcagatgctttttcagcaatgatgactagaagacataacaacagt
aatgtactttgtcttggtgaacgtgttctaggtgatagcctggcgttgcttctattggat
acatggctcgtggcagaatttgaaggcggtagacataatacaaggctccaaaaattggcg
gagcttgaggaacaggaggaagataaatga

DBGET integrated database retrieval system