KEGG   Listeria monocytogenes 08-5578: LM5578_0909Help
Entry
LM5578_0909       CDS       T01157                                 

Gene name
fbp
Definition
(GenBank) hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00010  Glycolysis / Gluconeogenesis
lmn00030  Pentose phosphate pathway
lmn00051  Fructose and mannose metabolism
lmn00680  Methane metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
lmn01130  Biosynthesis of antibiotics
lmn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5578_0909 (fbp)
   00030 Pentose phosphate pathway
    LM5578_0909 (fbp)
   00051 Fructose and mannose metabolism
    LM5578_0909 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LM5578_0909 (fbp)
Enzymes [BR:lmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LM5578_0909 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ADB67663
Position
complement(895636..897582)
Genome map
AA seq 648 aa AA seqDB search
MKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNGSGVVK
RKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELCQYVAS
KYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISALSLLI
QQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVCAANVI
RISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEITQIARM
HKAISIIQFKLEGEIIKRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFPTINPE
NPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPLHKDGT
FMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSLFGKSE
MTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPVKEGKG
ESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIKNETDI
LSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttacgcttgttagcaaaagaatatcctactatcgccaagacagctacggaa
atcattaacctcgaagcaattatgaaccttccaaaaggaacggaacattttttaagtgat
gttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggttctggtgttgtaaaa
cggaaaattcgtgatatttttggcgcagagctagatgatgcagagattaattcacttagt
acactgatttattatccagaagaaaagatggatttgattgctagtgaaacagaagatttg
catgcttggtatcgcaccacactttttcgtttgattgaactctgccagtatgttgcttca
aaatacacacgttctaaagttagaaaagccatgccagaagattttgcctacatattagaa
gagttacttcatgaaaactacaatgaagacgataaaaagctttattatgaagaaatttta
caacatattatttcacttggtcgtgcagaagaatttattagcgctctctcgctacttatt
caacaattggtcgtggatcatttgcacattgttggtgatgtttatgatcgtggcccttat
ccagataaaatcatggatacattaatgaattaccattcgctcgatttccagtggggtaat
cacgatattttatggatgggcgcggctagtggctctagggtttgtgcggctaatgttatt
cggatttctgctcgctatttaaatttagatattttagaagatagttacggtatttccctt
cgccccctagccctttttgccgacgaagtgtacaaagacgatccttgtacctacttccag
ccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacgcaaattgctaggatg
cacaaggctatctcgattattcagtttaaattggaaggtgaaattattaaacgacgcaaa
gaatttgatatgaatcatcggcttttacttcaatttatcgattacaaaaaaggcacaatt
caactaaaaggaaaagaataccagttgttagacaatcattttccaacgattaatccagaa
aatccttatgaacttactgatgcggagagagaacttattgggaaaattactgccgctttt
aaaaactgccgccgattgcaaaaacatgtacaatttctatattcaaaaggcagcatgttt
ttaacttataatggcaatttactctaccatggctgcattccgctccacaaagatgggact
tttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcgcttttagagcagttt
gaaatacttacccgcgaagcatacgtccgcccaactggaacaaaagaaaagaaatatgcg
tgtgatatcgtttggtatttgtggactggtgccatttcttcgctattcggaaaaagtgaa
atgactacgtttgaacgttattttgttgcagaaaaagaaacccacacagaggaaaaaaat
ccttattataaattgcgtaataacgaattaatttgcaaacaaattttagaagaatttgag
cttgacggagaatgcgggcatatcattaacggccatacgccagtcaaagaaggaaaaggt
gaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggcgggttcgcaaaagca
tatcataaagagacaaacttagcgggttatacactacttttcaacagttacggtttacaa
ctagttagtcatcagccatttactacaaaagaggatgctatcaaaaatgaaacggatatt
ctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgtgtaagggataccgat
attggggctaaacttagtgaacaggcagaagatttaaaattgctactagatgcttatcgt
aatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system