KEGG   Listeria monocytogenes 08-5578: LM5578_1065Help
Entry
LM5578_1065       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LM5578_1065
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LM5578_1065
Enzymes [BR:lmn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LM5578_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050526..1051005
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaacggcaaagaaatagctttaagtgat
tataaaggtaaagttttactcatagtgaataccgcgagtaaatgtggcttaacacctcaa
ttagaaggtcttgaagcaatgtataaaaaattgggtggagataattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagaccctggtagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccagatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaactggtggcaaaaaagtagaatgg
aactttgcgaaattcttaattgatgaaaatggagaagttgttgaacgtttcccatctaaa
atgaaacctgaagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

DBGET integrated database retrieval system