KEGG   Listeria monocytogenes 08-5578: LM5578_1116Help
Entry
LM5578_1116       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LM5578_1116
Enzymes [BR:lmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LM5578_1116
Exosome [BR:lmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM5578_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1099045..1100508
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKAGELVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIA
DILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKEICETLKEAGYE
KRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASHNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSTGSFGSYQEIPIHSVMADSEA
ALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGAPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPVEELSAIGVVEIAENKPKNKRTIAKLYQPSITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatagccattgatcaaagcacatctggtacgaaagtattattg
tttaaagcaggtgaactagtagatcgtttagataaaaagcatcgacagttgtatccaaag
aaaggctgggtggaacataatcccatcgaaatttgtcaaaatgtccgtacattaattgcg
gacatcttgacaaaacatgatttaattacagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacggggaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaaatttgcgaaacgttaaaagaagctggttatgaa
aaaagaattaaacagcttaccggactgaaaatcgattcttatttttctgcttctaaaatg
atgtggttattggaaaatatttcagcggtgcgggatgcagcaagtcataatcaattggca
tttggcacaatggacgcttggttgttattttcacttacggatgatagtaattatttcaca
gaccgaacaaatgctagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaacttttcggagtcaaacgtgcttatttaccagaagtgaaacaatctact
ggaagttttggaagttatcaggagataccaattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatacatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaagggattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggcgccccttattggaatacagatatacgagcagagattcttggcctcacg
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgataggtcaaaatattaagcgcttacaagta
gacggtgggttaacaaagcaacatgaattgatgcaatatttagctgatgttttaaaagca
gaagtggcagtcagtcccgtggaagaactttcggcaattggtgttgttgaaattgccgaa
aataaaccaaaaaataagagaacgatagcgaaattgtaccaaccaagtatcactcataca
catgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system