KEGG   Listeria monocytogenes 08-5578: LM5578_1214Help
Entry
LM5578_1214       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5578_1214
Enzymes [BR:lmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     LM5578_1214
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     LM5578_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197936..1198418
Genome map
AA seq 160 aa AA seqDB search
MMKYPIMLDITGKKVVIIGGGKVALRKITGLLDAGADILVVGLKILPEIKAMDVRVVEEA
YRPEHLKAAFMIFICTDNPEVNQCVLRDREAGQLVNDTTDQANSDFFNMATVTKNELIVG
ISTGGGNPSYAKKVKREVSQLVANLETEEIGKRNKNDKTC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatccgataatgcttgatattacagggaaaaaggttgtcataatcggtggc
gggaaagtggcgcttaggaaaattacgggtctgctggacgcaggtgcagatattttggta
gttggactaaagattttgccggagattaaggcgatggatgtgcgggtagtggaggaagct
tatcgaccggaacatcttaaagcagcatttatgatatttatttgtacagataatccagaa
gtaaatcagtgtgttttgcgtgaccgagaagcaggacaacttgtgaatgatacgactgac
caagcaaattctgatttttttaatatggcgacagtaacgaaaaatgaattaattgttggg
atttcaacgggtggaggtaatccaagttacgcgaagaaagtgaagcgtgaggttagtcaa
ttggtagcaaatttagaaacggaagaaatcggaaagcgtaataaaaatgataaaacctgc
taa

DBGET integrated database retrieval system