KEGG   Listeria monocytogenes 08-5578: LM5578_1214Help
Entry
LM5578_1214       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197932..1198414
Genome map
AA seq 160 aa AA seqDB search
MMKYPIMLDITGKKVVIIGGGKVALRKITGLLDAGADILVVGLKILPEIKAMDVRVVEEA
YRPEHLKAAFMIFICTDNPEVNQCVLRDREAGQLVNDTTDQANSDFFNMATVTKNELIVG
ISTGGGNPSYAKKVKREVSQLVANLETEEIGKRNKNDKTC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatccgataatgcttgatattacagggaaaaaggttgtcataatcggtggc
gggaaagtggcgcttaggaaaattacgggtctgctggacgcaggtgcagatattttggta
gttggactaaagattttgccggagattaaggcgatggatgtgcgggtagtggaggaagct
tatcgaccggaacatcttaaagcagcatttatgatatttatttgtacagataatccagaa
gtaaatcagtgtgttttgcgtgaccgagaagcaggacaacttgtgaatgatacgactgac
caagcaaattctgatttttttaatatggcgacagtaacgaaaaatgaattaattgttggg
atttcaacgggtggaggtaatccaagttacgcgaagaaagtgaagcgtgaggttagtcaa
ttggtagcaaatttagaaacggaagaaatcggaaagcgtaataaaaatgataaaacctgc
taa

DBGET integrated database retrieval system