KEGG   Listeria monocytogenes 08-5578: LM5578_1478Help
Entry
LM5578_1478       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00010  Glycolysis / Gluconeogenesis
lmn00052  Galactose metabolism
lmn00500  Starch and sucrose metabolism
lmn00520  Amino sugar and nucleotide sugar metabolism
lmn00521  Streptomycin biosynthesis
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
lmn01130  Biosynthesis of antibiotics
lmn01200  Carbon metabolism
Module
lmn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5578_1478
   00052 Galactose metabolism
    LM5578_1478
   00500 Starch and sucrose metabolism
    LM5578_1478
   00520 Amino sugar and nucleotide sugar metabolism
    LM5578_1478
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LM5578_1478
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LM5578_1478
Enzymes [BR:lmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LM5578_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADB68227
Position
1435449..1436417
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggtggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgctcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaacgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system