KEGG   Listeria monocytogenes 08-5578: LM5578_1654Help
Entry
LM5578_1654       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610238..1612634)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFDDTTEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDVKGIGFQRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQSILVAQVEKLAEEQKIIAENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMVG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgccttatttgatgatacaacggaagaacttttcatgaag
ggcacgatgttgtctaccattttttacaatgccgaaaacctcttttctgtcgtacgaata
ttggtaaaagaaacaaatgcggattgggacgaaaaagatattatcgtaactggctttttc
ccagcactccacgaacaagaagtctacactttctacggaaaaatgcaggaacatgctaaa
tttggtcaacaattcaaagcagaccggtttcgtaaagaaatgccacaatcacgcgctggt
ttaattaattatctttctggagaactttttaaaggaattggtaaagtaaccgctgaaaat
attgtggatacgattggtgatgatgctattacgaaaattttatccgatccgagtttgtta
aacacggtacctaagttgccatccggtgcagcggaaagtttgcttgcttcccttagagaa
aatcagggattagagcatgtgatggtcggtttaaacgaatatggctttggcccgcaatta
tccatgaaaattttccaggcctataaacaaaatgctattgaagtgttagagaataatcct
tataaattgattgaggacgtaaaagggattggttttcagcgtgccgatgagcttggacgg
aaactcggtcttggcgggaatcatccagaacggcttcgcgcagggattttatttatgtta
gattcggtttgtatgcaacaaggtcacgtatacatggagcaagaggttctgcttggagaa
gtgacatatttgctagaagaaagtgaaggcattcgaattgaccaaagtattttagtagct
caagtagaaaaattggccgaggaacaaaagattattgcggaaaacacacgcgtatacatg
ccatcgctctattattcagagagtggctttgcatatcatgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccacaatccgaatttttactagctctaggagaattagaa
gaaaggattggcgttcattacggagactcacaacgacaggctttagaacaagctttaatg
tctccgatgctcgtacttactggtggtcctggaacagggaaaacaacggtcattaaaggg
atagtggagctgtatgcggaactaaatggtgtgagtcttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggtcgtgccgctaaacggatgtca
gagtcaactggacttcctgcgatgactattcaccgtctactcggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgattgtggatgagatg
tcgatggttgatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtactcgttggcgaccaagatcagttgccttcagtcggaccgggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttatcgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtggtcgaacaagtggtaaaaaatgcaaaaaacaaagggtttcgagcaaaagatatccaa
gttttagcaccaatgtatcgtggtcccgcaggcattgatattttaaataaaaaactacaa
gaaatcttcaatccaaatgatacagggcgtcgtaaagaagttcaattcggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatatcggtgaaattgtttctataatctacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgattcataaagcgcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttacgtcgcgatttactctacactgga
gtaacgcggagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataagcgtaatacgacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacgaataaacgaattctcactgctgaaaacattacggaa
attgatccgatgattggaatggaagggattactccagaacagtttatggtaggataa

DBGET integrated database retrieval system