KEGG   Listeria monocytogenes 08-5578: LM5578_1728Help
Entry
LM5578_1728       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K00571  
site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
lmn  Listeria monocytogenes 08-5578
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694575..1695573)
Genome map
AA seq 332 aa AA seqDB search
MANEATQELFQVLDNTAIILQNELEISYLEAVYETGENLFQKEVLQKEELSSEKQLKLQE
SYESIELENFSNEEIRKGLQLALLKGMKHGIQVNHQMTPDSIGFIVAYLLEKVIQKKKNI
SILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQRQKMTLLHQD
GLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGMRYTKPGGYL
FFLVPDAMFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSEQARKSILILRKADVNVKPP
KEVLLANLSSLTDPSVTAPILAEIENWFKSKQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaatgaagcaacgcaagaattatttcaagtgcttgataatacagctattatcttg
caaaatgaacttgaaataagctatttggaagcggtttatgaaacaggagaaaatctgttt
caaaaagaagttttacaaaaagaagagttgtcttctgagaaacaattgaaattacaagag
tcttacgaaagtatcgaactcgagaatttctcaaatgaagaaatccgcaaaggtcttcaa
ttagcactactaaaaggcatgaaacatggtattcaagtgaaccaccaaatgacaccagat
tctattggttttattgtggcatatttacttgagaaagtgattcaaaagaagaaaaatatt
tctattttggatccagcctgtggaactgcaaaccttttaacgacggtgattaatcaactt
gagttaaaaggcgatgtagacgttcatgcgagtggtgtagatgtagatgatttgcttatt
tcgcttgcattagtaggagcggatttacagcgacaaaaaatgacgttgctacatcaagat
ggtctggctaatttattagtagatcctgtagatgttgtaattagtgatttgcctgttggg
tactatccggatgacgaaaatgcaaaaacatttgaactttgccgtgaagaagggcattca
tttgctcatttcttgtttatagaacaaggaatgcgctacacaaagccaggaggatatttg
ttcttcttggtacctgacgcaatgtttgggactagtgactttgctaaggtggacaagttt
atcaagaaaaacggtcatattgagggaattattaaattgcctgaaacactgtttaagtct
gaacaagcacgaaaaagcatcttgattttacgaaaagcggatgtaaatgtaaagccgcca
aaagaagttttactggccaatctctcttcgctaacagatccgagcgtaactgcaccgatt
ttagctgaaattgagaactggttcaagagtaaacaataa

DBGET integrated database retrieval system