KEGG   Listeria monocytogenes 08-5578: LM5578_1777Help
Entry
LM5578_1777       CDS       T01157                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01130  Biosynthesis of antibiotics
lmn01230  Biosynthesis of amino acids
Module
lmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LM5578_1777 (trpC)
Enzymes [BR:lmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LM5578_1777 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADB68525
Position
complement(1742879..1743637)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKEVEVAKMPLEQVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVQQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVGIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEKLITLFEQALALDLEVLVEVHDQEELAVAQKIGAQLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYDAVLVGEALMREAT
PEVAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagaagtagaagttgcaaaaatgccctta
gaacaagtagcagaaaaacggaaaacttattcgttttatgaatttttaaaagcaaataca
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccagttcagcaagccaagtcttatcaagccgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggttcgattgaagatttgcgagaagtagcg
aaaaatgtgggaattcctgtactctgtaaagatttcattattagtgaaaaacaattgatt
cgcgctcgaaatgcgggagcgacggttgtgttgttaattatttcggcacttacagaagag
aagctaatcaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccaggaagaattagctgttgctcaaaaaatcggagctcaactcattggtgtaaac
aatcggaatttgcacacatttgaagtggatattgcagtaagcgaaagactggcgagtgat
ttttcgtcggatgcttgttttataagcgaatcaggttttcgaacagcagaagatgtggct
cgcgtgagtcaaaaatatgatgcggtacttgttggagaagcgttaatgcgagaagcgact
ccagaagtggcagcgaagagtttgaaggtgacacgatga

DBGET integrated database retrieval system