KEGG   Listeria monocytogenes 08-5578: LM5578_1781Help
Entry
LM5578_1781       CDS       T01157                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00010  Glycolysis / Gluconeogenesis
lmn00071  Fatty acid degradation
lmn00350  Tyrosine metabolism
lmn00620  Pyruvate metabolism
lmn00625  Chloroalkane and chloroalkene degradation
lmn00626  Naphthalene degradation
lmn00650  Butanoate metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
lmn01130  Biosynthesis of antibiotics
lmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5578_1781
   00620 Pyruvate metabolism
    LM5578_1781
   00650 Butanoate metabolism
    LM5578_1781
  Lipid metabolism
   00071 Fatty acid degradation
    LM5578_1781
  Amino acid metabolism
   00350 Tyrosine metabolism
    LM5578_1781
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LM5578_1781
   00626 Naphthalene degradation
    LM5578_1781
Enzymes [BR:lmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LM5578_1781
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LM5578_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADB68529
Position
1747675..1750275
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDLQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaaccaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaataaaacagtcggagttattaacgaa
gacttacaaactggtgtgattgaaattgctgaaccagttggcgttgttgccggcgttaca
cctgtaactaacccaacatctactactcttttcaaagcaattatcgcgattaaaacgcgt
aacccaatcatctttgctttccatccaagtgcacaacgttgttcatcagcagcagcgaaa
gttgtatatgatgcagcaattgcagctggagctccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccatgataaagttgcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgtt
aatgacatcattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtaatcgtagacaaagaagtggctaaagaagtaaaagcagaaatggaagcaaacaactgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgttatcaaccctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcacgaaaaattaagcccagttcttgcatttatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatatggaggacttggacactccgca
gttattcactctactgataaagaagttcaaaaagcatttggtatccgtatgaaagcttgc
cgtatcattgtaaacgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacacttggttgtggatcttatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gatgttgtaatcgaacacttgaaaaaacgtggcaatgacgtatcttaccaagtatttgct
gacgttgaaccagatccatctgacgtaacagtttataaaggtgcagaactaatgaaagac
ttcaaaccggacacaattatcgctcttggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatattcgtaaacgtactttcaaatatcctaaacttggtggaaaagcaaaattcgtcgca
attccaacaacaagtggtacaggttctgaagtaacaccttttgcggttattacagacaaa
gaaaataacattaaataccctcttgctgactacgaattaactccagacgttgcgattgtc
gatgcacaatatgtaactactgttccagcacacattactgctgatactggtatggacgtt
ttaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtttttgaaaacttacgtgaatctgttcttactggtgat
ccagatgcgcgcgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcaaat
gcgttcctaggaatcaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgccaatgcaatccttatgccacatgttattcgttataacgcacttaaacct
aaaaaacatgcgttattcccaagatatgaaagtttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgctgcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagatttggatgctgttgtagatactcttgcagatcgcgcattcatggac
caatgtactacagccaaccctaaacaacctcttgtaagtgaactaaaagaaatctacctt
gaagcttacaaaggtgtttga

DBGET integrated database retrieval system