KEGG   Listeria monocytogenes 08-5578: LM5578_2029Help
Entry
LM5578_2029       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00230  Purine metabolism
lmn01100  Metabolic pathways
Module
lmn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LM5578_2029
Enzymes [BR:lmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LM5578_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 NB-ARC AAA_16 AAA_33 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADB68776
Structure
PDB: 

Jmol
Position
complement(2020940..2021560)
Genome map
AA seq 206 aa AA seqDB search
MMTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSR
EVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGI
FIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVSNAVQKI
KGIVETEHLKTERVIHRYKKMLEGLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaaagga
actgttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttctatg
acaacgcgtcttccgcgtgaaggcgaacaagacggggtcgattattattttcgttcaaga
gaagtttttgaacaagctatcaaagacggaaaaatgttagaatatgcagagtacgtcggt
aattattacggcactccgcttgaatatgtcgaggaaaaacttgccgcaggagtggatatt
tttctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcgatgccagaaggaatt
ttcattttcttaacgccaccagatttatccgaactgaaaaaccggattatcggtcgcggc
acagaatcgatggaagttgttgaggaacgcatggaaacagcgaaaaaagaaatcgaaatg
atggcgtcttatgattatgctgtggtgaatgatgtcgtatcaaacgccgtacaaaaaatc
aaaggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaa
atgttggagggattacaatga

DBGET integrated database retrieval system