KEGG   Listeria monocytogenes 08-5578: LM5578_2075Help
Entry
LM5578_2075       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lmn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2065869..2066351)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLHFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggaaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcattttttcaaaaaaacaacgactgggaaaacactt
gtcatggggcggaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system