KEGG   Listeria monocytogenes 08-5578: LM5578_2671Help
Entry
LM5578_2671       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5578_2671
   00052 Galactose metabolism
    LM5578_2671
Enzymes [BR:lmn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LM5578_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2664204..2665265)
Genome map
AA seq 353 aa AA seqDB search
MIFIEVMKERFGEFEGETVWKWTMINDHDMRMSVLNYGAIVTSLETKDKFGDFANINLGF
TNLDDYLAHSPYFGATLGPVAGRITNGQFSLDGKQFQLIQNEGSNHRHGGKFNFSKKLWD
VSVEKSLDQIVMTFEYCWADGENGYPGKIDAKMTYTLNNKNEWLIDYEARSNQPTIYNPS
NHIYFNLSGEAGSTVLQHQLWVNSDSFLPIDEEFLPIGEKRLAENTIFDLRAGREVAEIT
QSQDQQVKLVGAGLDHTFILKHENGRPDAVLFDPKSGRRLEMETKADSVLIYTANSLDGS
FEIDERAVPKYAGITMETQGLVDAINHDGFGDIVLRPEKPFTSRTAFRFTVES
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttatcgaagtaatgaaggagcgatttggggagtttgaaggagaaactgtttgg
aagtggacgatgataaatgatcatgatatgcgcatgagtgttttaaattacggagcgatt
gttacttcacttgaaacaaaagataaatttggtgattttgcgaatattaatcttggtttt
acaaatttagatgattatttggcacactctccttacttcggcgcgacacttggccctgtt
gctggacgtattacaaatgggcaatttagtttggatggcaaacaatttcaactgattcaa
aatgaaggctctaaccatcgtcacggtgggaaattcaattttagtaagaagctttgggat
gtttcagtagaaaaaagtcttgatcaaattgtgatgacttttgaatactgctgggcggat
ggagaaaatggctatccaggaaaaattgatgcaaaaatgacatatacgttaaataataaa
aatgaatggctgattgattatgaagcgagaagcaatcagccgactatatataacccgagc
aatcatatttattttaatctgagcggagaagctggttcaacggttttacaacatcagctt
tgggtcaatagtgatagcttcctaccaattgatgaagagttcctcccaattggggaaaag
cggttagcggaaaatactatctttgatttgcgtgcaggtcgtgaagtagcggagattaca
caaagtcaggaccagcaagtaaaattagttggtgcggggctggatcatacgttcatttta
aaacatgaaaatggtcgtccagatgcagttttgtttgatccaaagtcaggacggcgcttg
gaaatggaaaccaaagctgactcggtattaatttatacggcgaatagtttggatggctct
tttgagattgacgagcgagctgtgccaaaatatgctggcataacaatggaaacacagggt
ttggtggatgcgattaaccatgacggatttggtgatattgtacttcgaccagaaaaacct
tttacatctagaacagcttttcgtttcacagtggagagctga

DBGET integrated database retrieval system