KEGG   Listeria monocytogenes 08-5578: LM5578_2793Help
Entry
LM5578_2793       CDS       T01157                                 

Gene name
sul
Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LM5578_2793 (sul)
Enzymes [BR:lmn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LM5578_2793 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2796249..2797064)
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMVEDGAAIIDVGGISTRPG
FSEVTPDEELARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEP
KIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatggggatattgaatgttacgcca
gattctttttcagatggcgggaaatatatgcaagtagaagaagcggtggctcgagcgtta
caaatggtggaagatggagcagcgattattgacgttggaggaatatctactcgtcctggt
ttttcggaagtaacccccgatgaagaacttgcccgaattataccggtcattaaagctgtc
aggacgaaattacccgatatatggatttccgttgattcttggcgtgctgaagtagcggaa
caggctatcttagcgggagctgatatgataaatgaccagtggggtgcgaaaaaagaaccg
aaaattgccgaagttgctgcaaaatacgatgtaccgatttgtttaatgcacaatcgtgag
aacgcgcaatacgacaattttttagaagatgtgaaaaaagacttgttagaaagtattgcc
atagctaaagcagcatcagtaccagacgagcatattattctcgatccaggttttggtttt
gttaagacacctgctcagaatttagaagtgttacgacggattgatgagatagtcgcactt
ggttacgaggttttactcggtacgagcaggaagtcaactattgggctcgtcctaggaact
actcctggagatagaatggaaggaactggagcaacaactgtctatggattttcgaaaggt
tgtacaattactcgtgtccatgatgtacttccaattgcacgtatggtgcgaatgacagat
gcaatcactggcaaattagatattacaaatttataa

DBGET integrated database retrieval system