KEGG   Listeria monocytogenes 08-5578: LM5578_2828Help
Entry
LM5578_2828       CDS       T01157                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
lmn00900  Terpenoid backbone biosynthesis
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01130  Biosynthesis of antibiotics
Module
lmn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM5578_2828
Enzymes [BR:lmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LM5578_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADB69574
Position
complement(2834652..2835533)
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggatggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcgcactttatt
ccagaagatcgtcgcaatttaatttatcaagcggccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcatattcctgtttctgcgggacttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcagaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactggacgcggggagaaaatttctgcgttacctaat
attcctggttgttggattgtacttgctaagccgagcattagcgtgtcaacacccactatc
tataaagaacttcaagtagacaatgtagaacacccagacacacaaaaaatgattgaatcc
atcaaaaatggtgatctagacgggatttttgcggctacagggaatgtgctagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaattattaa

DBGET integrated database retrieval system