KEGG   Listeria monocytogenes 08-5578: LM5578_2834Help
Entry
LM5578_2834       CDS       T01157                                 

Definition
hypothetical protein
Orthology
K01182  
oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
lmn  Listeria monocytogenes 08-5578
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2839377..2841038)
Genome map
AA seq 553 aa AA seqDB search
MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELGVDVIWLSPVYDSPQD
DNGYDIRDYQKIYEEYGDMATFDQLLQGLHDRDMKLVMDLVVNHTSDEHKWFEESRKSKD
NPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSKKQPDLNWENPKLRQDVY
NMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDAGNDFCNGPRIHEFLQEMN
QEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFEHMNLDSDGDNKWDLKPIYL
PDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDNRFRVRSAKMLATCLHMMKGT
PYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGHSHESIMQSIYTKGRDNARTPY
QWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSIFYYYQNLIKLRKTTEIITTGNY
RLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISDENILNEIQKGSVLVNNVPNIIEG
TLRPYEAIVYQIK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagattggtggaaaaaaagcgtagtgtaccaaatctatccaaagagtttt
aatgattcgaatggtgatggagttggtgatattcaaggaattatcgagaaattagattat
ttaaaagagcttggtgtagacgttatctggttgtccccggtgtacgattcgccgcaagat
gacaatggttacgatattcgcgattatcaaaaaatttacgaagaatatggtgacatggcg
acttttgatcaattgcttcaaggtttacacgaccgcgatatgaaactcgtaatggactta
gttgttaaccatacttctgatgaacataagtggtttgaagaatctcggaaatccaaagat
aacccatatcgcgattactatttctggcgcgaggaaaacgaaatcaacaactggggttcc
attttcagcggtccggcatgggaattagacgaaaaaacaggcgagtactatttacacctg
ttctccaaaaaacaacctgatttaaactgggaaaaccctaaattgcgccaagatgtatat
aatatgatgaaattctggctagataaaggcattgatggtttccgcatggacgtaattaat
tttatttccaaaaacaccgatttcccagatggtccagtgccagatggtcaaatttacggc
gatgctggcaatgatttctgcaatggaccacggattcatgagttcttgcaagaaatgaac
caagaagttacttccaaatacgatgtgatgactgttggtgaaatgcctggtgctagtaca
actgacgcgcagatctatacgaatccagcaaataacgaagtcgatatgatttttacattt
gaacatatgaacttagattccgatggcgacaataaatgggatttgaaaccaatttactta
ccagatttaaaagaaaacatgtccgaatggcaagtggcgcttcaagaaaatggctggaac
agcttatactggaacaatcatgaccaaccacgaatcgtttctcgcttcggaaatgacaat
cgtttccgcgttcgttcagcgaaaatgctcgcaacttgtctgcatatgatgaaaggaacg
ccgtacatttatcaaggtgaagaaatcgggatgacgaatgttcattttgaaacgctagat
gattatcgtgatatcgaaacgctaaacatgtacaaagaacgcaaagagcaaggccacagt
cacgaaagcatcatgcagtcgatttacacaaaaggtcgcgacaatgcgagaaccccttat
cagtgggataatagcgagaatgctggcttcacaaccggaacgccttggcttaaagtcaac
ccgcgctatacagaaatcaacaacgaagaagcgctgaaaaaccctgattccattttctac
tactaccaaaatcttattaagttacgaaaaacgactgaaatcatcacaactggtaattat
cgcctgttattacctaaagacgaagcgattttcgcatatgaacgctacacagaaaatgaa
aaattagttgttttatgtaatttcacagaagaagaacaagttatttctgatgaaaacatt
ttgaacgaaatccaaaaaggttccgtgcttgtaaacaatgttccaaatattatagaagga
actttacgaccttacgaagcaatcgtttatcaaatcaagtaa

DBGET integrated database retrieval system