KEGG   Listeria monocytogenes EGD-e: lmo0226Help
Entry
lmo0226           CDS       T00066                                 

Gene name
folK
Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
233858..234337
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAAFLNIAVE
IETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKE
RAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcgtttctatcaattggcacaaatattggcgagcgtttagagaatttaaat
gacgcactaagaggtttagcggcttcgaatcaaattaatatcaccaacgtatctagcgta
tacgaaacagatgcagtaggttacgaagatcaagcagcatttttaaatatcgctgtagaa
attgaaacggactttccgccaattgatttattagatttttgccttgcgctcgaacttgaa
ttggggcgagttcgattatttaagtggggtccgcgactcattgatattgatgttttatta
tatgatgatgttaaaaccgatacagaaaagctaaaaatcccacatccttatatgaaagaa
cgtgcttttgtgatgattccattaatagaaatttcaccagaaaaaagcaatcttgtagag
aatccggcccttttggaagaacaaggtgttcggaaaataaaaaatcaagtcaactggtaa

DBGET integrated database retrieval system