KEGG   Listeria monocytogenes EGD-e: lmo0226Help
Entry
lmo0226           CDS       T00066                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lmo0226 (folK)
Enzymes [BR:lmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     lmo0226 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
233858..234337
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAAFLNIAVE
IETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKE
RAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcgtttctatcaattggcacaaatattggcgagcgtttagagaatttaaat
gacgcactaagaggtttagcggcttcgaatcaaattaatatcaccaacgtatctagcgta
tacgaaacagatgcagtaggttacgaagatcaagcagcatttttaaatatcgctgtagaa
attgaaacggactttccgccaattgatttattagatttttgccttgcgctcgaacttgaa
ttggggcgagttcgattatttaagtggggtccgcgactcattgatattgatgttttatta
tatgatgatgttaaaaccgatacagaaaagctaaaaatcccacatccttatatgaaagaa
cgtgcttttgtgatgattccattaatagaaatttcaccagaaaaaagcaatcttgtagag
aatccggcccttttggaagaacaaggtgttcggaaaataaaaaatcaagtcaactggtaa

DBGET integrated database retrieval system