KEGG   Listeria monocytogenes EGD-e: lmo0567Help
Entry
lmo0567           CDS       T00066                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00340  Histidine metabolism
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01230  Biosynthesis of amino acids
Module
lmo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    lmo0567 (hisD)
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     lmo0567 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 985596
NCBI-ProteinID: NP_464095
Pasteur: LMO00567
UniProt: Q8Y9G1
Position
complement(604121..605404)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTINELLNEVKAENNTNNSLQVESEVKSIIEKVKKDGDQALFDFTSQFDGVRLTE
LRVQTADIQSASSKVDPAFLVALQQAKANIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGIYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGINPHVLAAAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEINKQLENLPRKAIAQKSIETQ
GKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacaataaacgagctattaaacgaagtcaaagcagaaaacaat
accaataattcactccaagtcgaatccgaagtaaaatcgattatcgaaaaagtaaaaaaa
gatggcgaccaagccctgtttgacttcacatcccagtttgacggcgtacggctcaccgaa
ctacgcgtccagaccgctgatatccaaagtgcaagttccaaagtcgaccctgcctttcta
gtcgcactccaacaagcaaaagcaaatatcgaaagtttccacagcaagcaaaaacaacat
gcttttcttgatagcgaaaaagatggcgtcattcgcggtcaattaattcgtccactagaa
accgtcggcatatacgttcccggtggcacggcagcctatccatcatcggtattaatgaat
gtgttgcctgccaaaattgctggagtaaagcgaatcgtaatgatcacccctcctgccgaa
aacggtattaatcctcacgttttagccgcggctcaactagctggtgtggacgaaatttac
caagttggtggtgcgcatggaatcgcagctcttgctcacggaacagaatccatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtgttt
ggcttagttgatatcgacatgatagctggtccatccgaaatcgtcgtgctcgcagatgaa
aatgccaatcccgctttcattgcttccgacttactctcccaagcagagcatgatatttta
gctcgtgctatcttaatcactactagtaaaaaaatcgccgaggaaactcagaacgaaatt
aataaacagctagaaaatttacctcgaaaagcgattgctcagaaatccatcgaaacacaa
gggaaaatcattatcgcagcaaatacgcaagaaatgtttgatattatgaacgaaatcgct
cctgaacacttagaagtacaacttgaaaatccaatgaattacctcaatcaaattaaaaat
gccggttcgattttcttaggaagctatgcatcggaacctcttggcgactattttgccgga
ccaaatcacgtcttacctacaagtggtaccgcgaaattcttctctcctctcggcgtggaa
gatttcacgaaacgttctgcctttatttcttacacaaaagaagcactcgcaaaagaaaaa
gatgctattgttttacttgctaaaaaagaaggcctagatgcccatgccaaagccattcaa
attcgtttcgaggaggaaaactaa

DBGET integrated database retrieval system