KEGG   Listeria monocytogenes EGD-e: lmo0830Help
Entry
lmo0830           CDS       T00066                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00010  Glycolysis / Gluconeogenesis
lmo00030  Pentose phosphate pathway
lmo00051  Fructose and mannose metabolism
lmo00680  Methane metabolism
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01130  Biosynthesis of antibiotics
lmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo0830 (fbp)
   00030 Pentose phosphate pathway
    lmo0830 (fbp)
   00051 Fructose and mannose metabolism
    lmo0830 (fbp)
  Energy metabolism
   00680 Methane metabolism
    lmo0830 (fbp)
Enzymes [BR:lmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     lmo0830 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 985361
NCBI-ProteinID: NP_464357
Pasteur: LMO00830
UniProt: Q8Y8R5
Position
complement(859656..861617)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIIKRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFP
TINPENPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HKDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPV
KEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatcgcc
aagacagctacggaaatcattaacctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcagagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgattgctagt
gaaacagaagatttgcatgcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtatgttgcttcaaaatacacacgttctaaagttagaaaagccatgccagaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgataaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagcgct
ctctcactacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtttat
gatcgtggcccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggctctagggtttgt
gcggctaatgttattcggatttctgctcgctatttaaatttagatattttagaagatagt
tacggtatttcccttcgccccctagccctttttgccgacgaagtgtacaaagacgatcct
tgtacctacttccagccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacg
caaattgctaggatgcacaaggctatctcgattattcagtttaaattggaaggtgaaatt
attaaacgacgcaaagaatttgatatgaatcatcggcttttacttcaatttatcgattac
aaaaaaggcacaattcaactaaaaggaaaagaataccagttgttagacaatcattttcca
acgattaatccagaaaatccttatgaacttactgatgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgccgccgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggcaatttactctaccatggctgcattccgctc
cacaaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtccgcccaactggaacaaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
ttcggaaaaagtgaaatgactacgtttgaacgttattttgttgcagaaaaagaaacccac
acagaggaaaaaaatccttattataaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgagcttgacggagaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggc
gggttcgcaaaagcatatcataaagagacaaacttagcgggttatacactacttttcaac
agttacggtttacaactagttagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgaacaggcagaagatttaaaattgcta
ctagatgcttatcgtaatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system