KEGG   Listeria monocytogenes EGD-e: lmo0917Help
Entry
lmo0917           CDS       T00066                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo0917
Enzymes [BR:lmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lmo0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
952318..953769
Genome map
AA seq 483 aa AA seqDB search
MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGKTNDEISEEQHKGVSL
ADIKASIEDKINYYPKRHGIDFYHTYPEDLELLAEMGFKTFRTSLDWTRIFPTGEETEPN
EAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHNRKVIDLFEKYGKTVLDR
YNKKVKYWIVINQINLIQFEPFNSTAIPYDAVDDYLSATYQAVHNQFVASAKIYEYGKAL
NPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADVQFQGEYPQYALNYFEENNI
HIEITEEDKAILQKNTMDYLALSYYYSQMVDSKRNDLDPASITPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDYRIDYLSAHLKEMKRAMYGGVE
IIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGTGKRIKKDSFSWYKKVIESNGED
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattatcaatttccgaaagacttcttatggggtggggccatcgcagccaac
caagcagaaggcgcatttaaagtagatggaaaaggaattagtttagcagatttgcacaaa
tatcataaaggtaaaacaaatgatgagattagcgaggaacagcataaaggagtaagttta
gctgatatcaaagcaagtatagaggataaaataaactattatccgaaacgccacggtatc
gatttttatcacacgtatccagaagacttggagttgcttgctgaaatgggttttaaaaca
ttccgaacttcactggactggacacggatttttccaactggcgaagaaactgaaccaaat
gaagcgggattaaaatattatgaccaattaatcgataaaattatcgaacttggcatggag
ccaattattacgattttacattacgaaactcccgtggaaattgttttaaatcatggcggg
tggcacaatcgtaaagtcattgatttatttgagaagtacggcaaaacagtacttgatcgc
tacaataaaaaagtaaaatattggattgtcattaaccaaattaatttaattcaattcgaa
ccatttaactctactgcgattccatacgatgcagttgatgattatttatccgcaacatat
caagcagttcacaatcaatttgtcgcaagtgcaaaaatttatgaatacggaaaggcactg
aaccctgatttaatgattggtacaatgctagctgattgtacggcctatccattctcatgc
gatccggatgatatcgtcctcgcaatgaaacgtaatcgtatggaatatttcttcgcagat
gtgcagttccaaggcgaatatccacaatatgcgcttaactacttcgaagaaaataatatt
catattgaaattacagaagaagacaaagctattttgcaaaaaaataccatggattatcta
gcgctttcctattattattcacaaatggtagattccaaaagaaatgatttggacccagct
tcgattacaccaaacccgcatcttaaagctaatccgtggggctgggcagtcgatccaaaa
gggctatataatgctctgtcacaatactgggatagataccataaaccaattattattgct
gaaaatggtttcggcatgtatgacaaattggaaaatggcgaaatccacgatgattaccga
atcgattatttatccgcccatctaaaagaaatgaaacgtgctatgtatggtggcgtagaa
ataatcgcatattgcgcttggggaccgattgatatcgtcagctgttcttccgcacaaatg
gaaaaaagatacggtttcatttacgttgatttagataacgaaggaaacggcacaggcaaa
agaattaaaaaagacagcttttcatggtataaaaaagtaatagagtctaatggggaagac
ttagaagcttaa

DBGET integrated database retrieval system