KEGG   Listeria monocytogenes EGD-e: lmo0933Help
Entry
lmo0933           CDS       T00066                                 

Definition
(RefSeq) sugar transferase
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
lmo  Listeria monocytogenes EGD-e
Brite
Enzymes [BR:lmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     lmo0933
Lipopolysaccharide biosynthesis proteins [BR:lmo01005]
 O-antigen
  lmo0933
Transporters [BR:lmo02000]
 Other Transporters
  Others
   lmo0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(969549..970496)
Genome map
AA seq 315 aa AA seqDB search
MEKSIEYSCIVPVFNEEEVLLKTYKRLTEVMQTLDGPYEIIFVNDGSRDLTKSMLQKLSA
EDSCVKAIHFSRNFGHQIAITAGANYAHGKAVIVIDADLQDPPELIIEMVEKWKEGYQVV
YAQRLKRKGETFFKKQSASLFYRILTKLTDINIPVDTGDFRLMDAQVCRELAGLHEKNPF
VRGQVSWLGFKQTALHYERDERAAGETKYPLKKMIKLSIDGITSFSYRPLKLASYLGVLT
AFIGFIYLIIVLFQRFFTDTTLTGWTSIIILQLVFGGTILFILGLIGEYIGRIYDEVKDR
PLYIIEEENGFSDQK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagtattgaatactcctgtatagtccctgtttttaatgaagaagaagttcta
ctaaaaacatataaacggcttacagaagtcatgcaaacacttgacggtccctacgaaatt
atttttgtaaatgatggtagtcgagatctcacgaagagtatgttgcaaaagttaagcgca
gaagatagttgtgtaaaagcaatccatttttcgaggaattttgggcatcagattgctatt
actgccggtgccaattatgctcacggtaaagctgttattgtaattgatgcagatttacaa
gatcctcctgaattaattattgaaatggttgagaaatggaaagaaggctatcaagttgta
tatgcacagcgcctcaaacgaaaaggcgagactttctttaaaaaacaaagcgcttctctt
ttttatcgtattttaactaaattaacagatatcaatattccagttgatacaggggatttc
cggcttatggatgcgcaagtttgtcgcgaactcgctggcttacatgagaaaaaccccttt
gttcgtggccaagtaagttggcttggctttaaacaaacagcccttcattatgaacgagat
gaacgcgcggctggagaaacaaaatatccactcaaaaaaatgattaaattatctatagat
ggtatcacctctttttcttatcggcccttaaaacttgcaagctatcttggcgttttaaca
gcatttattggctttatttacttaattatagtgctcttccaacgattctttactgataca
acattaacgggctggacttctattattattttacaacttgtttttggagggacaattctt
ttcattctgggattaattggtgaatacattggtcgaatttatgatgaagtaaaagatcgt
ccgctttatattatagaagaagaaaatggtttttctgaccaaaaataa

DBGET integrated database retrieval system