KEGG   Listeria monocytogenes EGD-e: lmo0933Help
Entry
lmo0933           CDS       T00066                                 

Definition
hypothetical protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Metabolic pathways
Brite
Enzymes [BR:lmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     lmo0933
Glycosyltransferases [BR:lmo01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   lmo0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(969549..970496)
Genome map
AA seq 315 aa AA seqDB search
MEKSIEYSCIVPVFNEEEVLLKTYKRLTEVMQTLDGPYEIIFVNDGSRDLTKSMLQKLSA
EDSCVKAIHFSRNFGHQIAITAGANYAHGKAVIVIDADLQDPPELIIEMVEKWKEGYQVV
YAQRLKRKGETFFKKQSASLFYRILTKLTDINIPVDTGDFRLMDAQVCRELAGLHEKNPF
VRGQVSWLGFKQTALHYERDERAAGETKYPLKKMIKLSIDGITSFSYRPLKLASYLGVLT
AFIGFIYLIIVLFQRFFTDTTLTGWTSIIILQLVFGGTILFILGLIGEYIGRIYDEVKDR
PLYIIEEENGFSDQK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagtattgaatactcctgtatagtccctgtttttaatgaagaagaagttcta
ctaaaaacatataaacggcttacagaagtcatgcaaacacttgacggtccctacgaaatt
atttttgtaaatgatggtagtcgagatctcacgaagagtatgttgcaaaagttaagcgca
gaagatagttgtgtaaaagcaatccatttttcgaggaattttgggcatcagattgctatt
actgccggtgccaattatgctcacggtaaagctgttattgtaattgatgcagatttacaa
gatcctcctgaattaattattgaaatggttgagaaatggaaagaaggctatcaagttgta
tatgcacagcgcctcaaacgaaaaggcgagactttctttaaaaaacaaagcgcttctctt
ttttatcgtattttaactaaattaacagatatcaatattccagttgatacaggggatttc
cggcttatggatgcgcaagtttgtcgcgaactcgctggcttacatgagaaaaaccccttt
gttcgtggccaagtaagttggcttggctttaaacaaacagcccttcattatgaacgagat
gaacgcgcggctggagaaacaaaatatccactcaaaaaaatgattaaattatctatagat
ggtatcacctctttttcttatcggcccttaaaacttgcaagctatcttggcgttttaaca
gcatttattggctttatttacttaattatagtgctcttccaacgattctttactgataca
acattaacgggctggacttctattattattttacaacttgtttttggagggacaattctt
ttcattctgggattaattggtgaatacattggtcgaatttatgatgaagtaaaagatcgt
ccgctttatattatagaagaagaaaatggtttttctgaccaaaaataa

DBGET integrated database retrieval system