KEGG   Listeria monocytogenes EGD-e: lmo1082Help
Entry
lmo1082           CDS       T00066                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lmo1082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lmo1082
Enzymes [BR:lmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lmo1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1116532..1117092
Genome map
AA seq 186 aa AA seqDB search
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRG
MHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHG
FCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENN
FVWENK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgaaagtaaactagctggtgttaaattagtaaaaccaaaagtgtttgga
gatcatcgtggttttttcatggaaagctataatgaaaaagcattccatgaagctggaatc
gatatgaagtttattcaagataaccactctctttctgtggaagcgggtgtacttcggggt
atgcattatcaaacgaacccaaaagcacagacaaaattaattcgtgttgcgacaggcgca
atttatgatgtagttgttgatatgcgtaaaggttctcctacatacggtgagtgggaaggt
tatattttaagcgaagcaaacaaacatcaacttctagtaccacaaggatttgctcatggc
ttttgtacgattaccgaaaatgtgaatgtgctttataaagtagatcaattatattcccct
gaaaacgatgcgggaattgcctacgatgatccggatttaaatattacttggccaacagat
aaattaattttatcggacaaggatacgaaacatccacgtttaaaagacgctgaaaataat
tttgtatgggagaataaataa

DBGET integrated database retrieval system