KEGG   Listeria monocytogenes EGD-e: lmo1317Help
Entry
lmo1317           CDS       T00066                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00900  Terpenoid backbone biosynthesis
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01130  Biosynthesis of antibiotics
Module
lmo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lmo1317
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     lmo1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 987697
NCBI-ProteinID: NP_464842
Pasteur: LMO01317
UniProt: Q8Y7G4
Position
1342682..1343824
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKT
REQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttcaattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaaccaaaaatggtcgctgtttggcatacgaga
gatcgtgttaccttagaagcagaattcccaaatgtgaaattttttaatggtttagaagga
cttagagaagtagcgacctatttagatggggacgttcttttaaatgcagttatggggagc
gttggactacttcctacattagatgcaatcgaagctgggaaggccattgcaatagctaat
aaagaaacacttgtcacggctggacatttagttatgcgtgcggcgaaagaaaagaacatt
tctctattacccgttgatagtgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaaataattttgacagcgagcggtggaagtttccgagataagacg
agggagcaactcagcgcggttacggtgaaagaagcgttaaagcatccgaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtagattacgatgatattgaggtagttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactctatataccgtat
gaaaaagaattccggatcactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgttgctggctttttaaatggacaggtagctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagcatttctaatcct
gacttggatacgattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system