KEGG   Listeria monocytogenes EGD-e: lmo1339Help
Entry
lmo1339           CDS       T00066                                 

Definition
(RefSeq) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00010  Glycolysis / Gluconeogenesis
lmo00052  Galactose metabolism
lmo00500  Starch and sucrose metabolism
lmo00520  Amino sugar and nucleotide sugar metabolism
lmo00521  Streptomycin biosynthesis
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01130  Biosynthesis of antibiotics
lmo01200  Carbon metabolism
Module
lmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo1339
   00052 Galactose metabolism
    lmo1339
   00500 Starch and sucrose metabolism
    lmo1339
   00520 Amino sugar and nucleotide sugar metabolism
    lmo1339
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lmo1339
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    lmo1339
Enzymes [BR:lmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lmo1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 987723
NCBI-ProteinID: NP_464864
Pasteur: LMO01339
UniProt: Q8Y7E4
Position
1366457..1367425
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggcggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgcgcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaacgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system