KEGG   Listeria monocytogenes EGD-e: lmo1339Help
Entry
lmo1339           CDS       T00066                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lmo1339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo1339
   00052 Galactose metabolism
    lmo1339
   00500 Starch and sucrose metabolism
    lmo1339
   00520 Amino sugar and nucleotide sugar metabolism
    lmo1339
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lmo1339
   00524 Butirosin and neomycin biosynthesis
    lmo1339
Enzymes [BR:lmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lmo1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1366457..1367425
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggcggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgcgcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaacgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system