KEGG   Listeria monocytogenes EGD-e: lmo1533Help
Entry
lmo1533           CDS       T00066                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lmo1533 (ruvA)
Enzymes [BR:lmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lmo1533 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1568420..1569025)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEADLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgttgag
gcaggacaaatcggctatcaaataattacagggaacccgttttcctttcaacgactagaa
ggtacagaagcgcaagtctttttgtatcagcatgtgagagaggataatatttctttattt
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcactagccattattgcttcaggcgatgtcgttccactaatttcagcg
attgaatccgaagacgatgtttatttaaccaaatttccgagtgtcggtaaaaaaacagct
cgccaaattattcttgatttaaaaggaaaactggctgatgttgttgcgagcgaaattgtt
tatgttgccccagaaaacgatatggttgcgggactttccccgcaattagaagaggccgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gctaaagaagctgacttaacaagcgacgcatatatcaagctagcgctacaattaatgaca
aaatag

DBGET integrated database retrieval system